@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu27030: (2016-07-12 )
MKKRLIQVMIMFTLLLTMAFSADAADSSYYDEDYRPQYHFTPEANWMNDPNGMVYYAGEYHLFYQYHPYGLQWGPMHWGHAVSKDLVTWEHLPVALYPDEKGTIFSGSAVVDKNNTSGFQTGKEKPLVAIYTQDREGHQVQSIAYSNDKGRTWTKYAGNPVIPNPGKKDFRDPKVFWYEKEKKWVMVLAAGDRILIYTSKNLKQWTYASEFGQDQGSHGGVWECPDLFELPVDGNPNQKKWVMQVSVGNGAVSGGSGMQYFVGDFDGTHFKNENPPNKVLWTDYGRDFYAAVSWSDIPSTDSRRLWLGWMSNWQYANDVPTSPWRSATSIPRELKLKAFTEGVRVVQTPVKELETIRGTSKKWKNLTISPASHNVLAGQSGDAYEINAEFKVSPGSAAEFGFKVRTGENQFTKVGYDRRNAKLFVDRSESGNDTFNPAFNTGKETAPLKPVNGKVKLRIFVDRSSVEVFGNDGKQVITDIILPDRSSKGLELYAANGGVKVKSLTIHPLKKVWGTTPFMSNMTGWTTVNGTWADTIEGKQGRSDGDSFILSSASGSDFTYESDITIKDGNGRGAGALMFRSDKDAKNGYLANVDAKHDLVKFFKFENGAASVIAEYKTPIDVNKKYHLKTEAEGDRFKIYLDDRLVIDAHDSVFSEGQFGLNVWDATAVFQNVTKES

Atome Classification :

(32 SA) .........10........20........30...-.....40........50....--..--..--60........70...-.....80........90.......-----.-100---...-......110.......120---....---...130.-------------..---.-------------.---.-------.140--......----.150....-.-..160..--------.-----------..------.---.----170.......180.....--..190---.--.-----.......200......-.210...----....220.......230....-----------...240.......250.-----.-----.....260....--.--..270..----.-----.-----...280........290.......300.......310...-..-..320-...---......330.....-----..-----340---..-.......350.-----........360..-..--...370.....-..380.......390----..--------------------------.--------------------------..--------...400.....----.--.--410----.......420---------.-------......430....-...440.--.....---.---450..-----......460---.........470.......480...----.--.---..490....---.-.--.500.......510.......520.......530.......540.......550.......560.......570.......580.......590.......600.......610.......620.......630.......640.......650.......660.......670.....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MKKRLIQVMIMFTLLLTMAFSADAADSSYYDEDY-RPQYHFTPEANWMNDPNGMVY--YA--GE--YHLFYQYHPYGLQWG-PMHWGHAVSKDLVTWEHLPVALYP-----D-E-----KGT-IFSGSAVVDKNNTSGFQTG---KEKP---LVAIYTQ-------------DR---E-------------G---H-------QVQS--IAYSND----KGRTWTKY-A-GNPVIPN--------P-----------GK------K---D----FRDPKVFWYEKEKKWVMV--LAA-----G--D-----RILIYTSKNLKQWTYA-SEFGQDQ----GSHGGVWECPDLFELPVDGNP-----------NQKKWVMQVSVGNGAVS-----G-----GSGMQYFVGDFD--G--THFKNEN----P-----P-----NKVL-WTDYGRDFYAAVSWSDIPSTDSRRLWLGWMSNWQY-AN-DVP---TSP---WRSATSIPRELKLK-----AF-----T-----EG-VRVVQTPV--K-----ELETIRGTSKKWK-NL--TISPASHNVLA-GQSGDAYEINAEFK-----VS--------------------------P--------------------------GS--------AAEFGFKVRTG----E--N--QFT----KVGYDRRNAK---------L-------FVDRSESGNDTFN-PAFNTGK--ETAPL---K---P-VNG-----KVKLRIF-----VDRSSVEVFGNDGKQVITDIILPDR----S--S---KGLELYAAN---G-G--VKVKSLTIHPLKKVWGTTPFMSNMTGWTTVNGTWADTIEGKQGRSDGDSFILSSASGSDFTYESDITIKDGNGRGAGALMFRSDKDAKNGYLANVDAKHDLVKFFKFENGAASVIAEYKTPIDVNKKYHLKTEAEGDRFKIYLDDRLVIDAHDSVFSEGQFGLNVWDATAVFQNVTKES
51 HHSearch 85.4238% 18 * C3 *3SC7 INU2_ASPFI X:[24-514] -----------------------------QSNDY-RPSYHFTPDQYWMNEPNGLIK--IG--ST--WHLFFQHNPTANVWG-NICWGHATSTDLMHWAHKPTAIAD-----E-N-----GVE-AFTGTAYYDPNNTSGLGDS---ANPP---YLAWFTG-------------YTTS-S-------------Q---T-------QDQR--LAFSVD----NGATWTKF-Q-GNPIISTSQEA----PHDIT-------GG------L---E----SRDPKVFFHRQSGNWIMV--LAHGG---Q--D-----KLSFWTSADTINWTWQ-SDLKSTSINGLSSDITGWEVPDMFELPVEGT------------EETTWVVMMTPAEGSPA-----G-----GNGVLAITGSFD--G--KSFTADP----V-----D-----ASTM-WLDNGRDFDGALSWVNVPASDGRRIIAAVMNSYGS----NPP---TTT---WKGMLSFPRTLSLK-----KV-----G-----TQ-QHFVQQPI--T-----ELDTISTSLQILA-NQ--TITPGQ-TLLS-SIRGTALDVRVAFY-----P------------------------------------------------------DA--------GSVLSLAVRKG----A--S--EQT----VIKYTQSDAT---------L-------SVDRTESGDISYD-PAAG-GV--HTAKL---EE--D-GTG-----LVSIRVL-----VDTCSVEVFGGQGEAVISDLIFPSD----S--S---DGLALEVTG---G-N--AVLQSVDVRSVS-----------------------------------------------------------------------------------------------------------------------------------------------------------------------
7 PsiBlast_PDB 83.2035% 20 - C3 -3SC7 INU2_ASPFI X:[24-514] ----------------------QS-------NDY-RPSYHFTPDQYWMNEPNGLIK--IG--ST--WHLFFQHNPTANVWG-NICWGHATSTDLMHWAHKPTAIAD-----E-N-----GVE-AFTGTAYYDPNNTSGLGDS---ANPP---YLAWFTG-------------YT---T-------------S---S-------QTQDQRLAFSVD----NGATWTKF-Q-GNPIIST--------SQEAPHDIT---GG------L---E----SRDPKVFFHRQSGNWIMV--LAH-----GGQD-----KLSFWTSADTINWTWQ-SDLKSTSINGLSSDITGWEVPDMFELPVEGT------------EETTWVVMMTPAEGSPA-----G-----GNGVLAITGSFD--G--KSFTADP----V-----D-----ASTM-WLDNGRDFDGALSWVNVPASDGRRIIAAVMNS--Y-GS-NPP---TTT---WKGMLSFPRTLSLK-----KV-----G-----TQ-QHFVQQPI--T-----ELDTISTSLQILA-NQ--TITPG-QTLLS-SIRGTALDVRVAFY---------------------------------P--------------------------DA--------GSVLSLAVRKG----A--S--EQT----VIKYTQSDAT---------L-------SVDRTESGDISYD-PAAG-GV--HTAKL---E---EDGTG-----LVSIRVL-----VDTCSVEVFGGQGEAVISDLIFPSD----S--S---DGLALEVTG---G-N--AVLQSVDVRSVS-----------------------------------------------------------------------------------------------------------------------------------------------------------------------
57 HHSearch 82.0433% 3 - C3 -4FFH ? A:[2-481] ------------------------------------AVYHMTPPSGWLCNPQRPVT--TH--GA--YQLYYLHSDQN--NG-PGGWDHASTTDGVAFTHHGTVMPL-----R-P-----DFP-VWSGSAVVDTANTAGFGAG------A---VVALATQ-------------PTDGVR-------------K---Y-------QEQY--LYWSTD----GGFTFTAL-P--DPVIVNT-------DGRAATTPAEIENA------E---W----FRDPKIHWDTARGEWVCV--IGR-----L--R-----YAAFYTSPNLRDWTLR-RNFDYPN-----HALGGIECPDLFEITADD-------------GTRHWVLAASMDAYGIG-----L-----PMTYAYWTGTWD--G--EQFHADD----------------LTPQ-WLDWGWDWYAAVTWPSIDAPETKRLAIAWMNNWKY-AARDVPTDASDG---YNGQNSIVRELRLA-----RQP----G-----GW-YTLLSTPV--A-----ALTNYVTATTTLP-DR--TV-DG--SAVL-PWNGRAYEIELDIA-----W------------------------------------------------------DT--------ATNVGISVGRS----PDGT--RHT----NIGKY--GAD---------L-------YVDRGPSDLAGYS-LAPY-SR--AAAPI---D---P-GAR-----SVHLRIL-----VDTQSVEVFVNAGHTVLSQQVHFAE----G--D---TGISLYTDG---G-P--AHFTGIVVREIGQA---------------------------------------------------------------------------------------------------------------------------------------------------------------------
8 PsiBlast_PDB 81.0035% 23 - C3 -3RWK INU2_ASPFI X:[24-514] ----------------------QS-------NDY-RPSYHFTPDQYWMNEPNGLIK--IG--ST--WHLFFQHNPTANVWG-NICWGHATSTDLMHWAHKPTAIAD-----E-N-----GVE-AFTGTAYYDPNNTSGLGDS---ANPP---YLAWFTG-------------YT---T-------------S---S-------QTQDQRLAFSVD----NGATWTKF-Q-GNPIIST--------SQEAPHDIT---GG------L---E----SRDPKVFFHRQSGNWIMV--LAH-----GGQD-----KLSFWTSADTINWTWQ-SDLKSTSINGLSSDITGWEVPDMFELPVEGT------------EETTWVVMMTPAEGSPA-----G-----GNGVLAITGSFD--G--KSFTADP----V-----D-----ASTM-WLDNGRDFDGALSWVNVPASDGRRIIAAVMNS--Y-GS-NPP---TTT---WKGMLSFPRTLSLK-----KV-----G-----TQ-QHFVQQPI--T-----ELDTISTSLQILA-NQ--TITPG-QTLLS-SIRGTALDVRVAFY---------------------------------P--------------------------DA--------GSVLSLAVRKG----A--S--EQT----VIKYTQSDAT---------L-------SVDRTESGDISYD-PAAG-GV--HTAKL---E---EDGTG-----LVSIRVL-----VDTCSVEVFGGQGEAVISDLIFPSD----S--S---DGLALEVTG---G-N--AVLQSVDVRSVS-----------------------------------------------------------------------------------------------------------------------------------------------------------------------
52 HHSearch 80.9844% 50 - C3 -1Y4W INUE_ASPAW A:[3-517] -----------------------------YDQPY-RGQYHFSPQKNWMNDPNGLLY--HN--GT--YHLFFQYNPGGIEWG-NISWGHAISEDLTHWEEKPVALLA-----R-GFGSDVTEM-YFSGSAVADVNNTSGFGKD---GKTP---LVAMYTS-------------YY---PVAQTLPSGQTVQED---Q-------QSQS--IAYSLD----DGLTWTTY-DAANPVIPNP-------PSPYEA------EY------Q---N----FRDPFVFWHDESQKWVVV--TSIAE---L--H-----KLAIYTSDNLKDWKLV-SEFGPY-----NAQGGVWECPGLVKLPLDSG------------NSTKWVITSGLNPGGPPGT---V-----GSGTQYFVGEFD--G--TTFTPDA----DTVYPGN-----STAN-WMDWGPDFYAAAGYNGLS--LNDHVHIGWMNNWQY-GA-NIP---TYP---WRSAMAIPRHMALK-----TI-----G-----SK-ATLVQQPQ--E-----AWSSISNKRPIYS-RTFKTLSEGS--TNT-TTTGETFKVDLSFS-----AK-----------------------------------------------------SK--------ASTFAIALRAS----ANFT--EQT----LVGYDFAKQQ---------I-------FLDRTHSGDVSFD-ETFA-SV--YHGPL---TP--D-STG-----VVKLSIF-----VDRSSVEVFGGQGETTLTAQIFPSS----D--A---VHARLASTG---G-T--TEDVRADIYKIASTW--------------------------------------------------------------------------------------------------------------------------------------------------------------------
1 PsiBlast_PDB 79.9641% 46 - C3 -1Y9M INUE_ASPAW A:[3-517] -----------------------------YDQPY-RGQYHFSPQKNWMNDPNGLLY--HN--GT--YHLFFQYNPGGIEWG-NISWGHAISEDLTHWEEKPVALLARGFGSD-V-----TEM-YFSGSAVADVNNTSGFGKD---GKTP---LVAMYTSYYPVAQTLPSGQTVQ---E-------------D---Q-------QSQS--IAYSLD----DGLTWTTYDA-ANPVIPN--------P-----------PSPYEAEYQ---N----FRDPFVFWHDESQKWVVVTSIAE-----L--H-----KLAIYTSDNLKDWKLV-SEFGP-Y----NAQGGVWECPGLVKLPLDSG------------NSTKWVITSGLNPGGPP-----GTV---GSGTQYFVGEFD--G--TTFTPDADTVYP-----G-----NSTANWMDWGPDFYAAAGYNGLSLND--HVHIGWMNNWQY-GA-NIP---TYP---WRSAMAIPRHMALK-----TI-----G-----SK-ATLVQQPQ--E-----AWSSISNKRPIYS-RT--FKTLSEGSTNT-TTTGETFKVDLSFS-----AK-----------------------------------------------------SK--------ASTFAIALRAS----A--NFTEQT----LVGYDFAKQQ---------I-------FLDRTHSGDVSFD-ETFASVY--H-GPL---T---PDSTG-----VVKLSIF-----VDRSSVEVFGGQGETTLTAQIFPSS----D--A---VHARLASTG---G-T--TEDVRADIYKIASTW--------------------------------------------------------------------------------------------------------------------------------------------------------------------
3 PsiBlast_PDB 79.3341% 44 - C3 -1Y4W INUE_ASPAW A:[3-517] -----------------------------YDQPY-RGQYHFSPQKNWMNDPNGLLY--HN--GT--YHLFFQYNPGGIEWG-NISWGHAISEDLTHWEEKPVALLARGFGSD-V-----TEM-YFSGSAVADVNNTSGFGKD---GKTP---LVAMYTSYYPVAQTLPSGQTVQ---E-------------D---Q-------QSQS--IAYSLD----DGLTWTTYDA-ANPVIPN--------P-----------PSPYEAEYQ---N----FRDPFVFWHDESQKWVVVTSIAE-----L--H-----KLAIYTSDNLKDWKLV-SEFGP-Y----NAQGGVWECPGLVKLPLDSG------------NSTKWVITSGLNPGGPP-----GTV---GSGTQYFVGEFD--G--TTFTPDADTVYP-----G-----NSTANWMDWGPDFYAAAGYNGLSLND--HVHIGWMNNWQY-GA-NIP---TYP---WRSAMAIPRHMALK-----TI-----G-----SK-ATLVQQPQ--E-----AWSSISNKRPIYS-RT--FKTLSEGSTNT-TTTGETFKVDLSFS-----AK-----------------------------------------------------SK--------ASTFAIALRAS----A--NFTEQT----LVGYDFAKQQ---------I-------FLDRTHSGDVSFD-ETFASVY--H-GPL---T---PDSTG-----VVKLSIF-----VDRSSVEVFGGQGETTLTAQIFPSS----D--A---VHARLASTG---G-T--TEDVRADIYKIASTW--------------------------------------------------------------------------------------------------------------------------------------------------------------------
19 PsiBlast_PDB 79.2231% 15 - C3 -4FFI ? A:[4-480] --------------------------------------YHMTPPSGWLCNPQRPVT--TH--GA--YQLYYLHSDQNN--G-PGGWDHASTTDGVAFTHHGTVMPL-----R-P-----DFP-VWSGSAVVDTANTAGFGAG---A------VVALATQ-------------PT---D-------------GVRKY-------QEQY--LYWSTD----GGFTFTAL-P--DPVIVNTDGRAATTP-----------AE------I---ENAEWFRDPKIHWDTARGEWVCV--IGR-----L--R-----YAAFYTSPNLRDWTLR-RNFDYPN----HALGGI-ECPDLFEITADDG-------------TRHWVLAASMDAYGIG-----L-----PMTYAYWTGTWD--G--EQFHADD----L-----T-----PQ---WLDWGWDWYAAVTWPSIDAPETKRLAIAWMNNWKYAAR-DVP---TDASDGYNGQNSIVRELRLA-----RQ-----P-----GGWYTLLSTPV--A-----ALTNYVTATTTLP-DR--TVDGSA---VL-PWNGRAYEI--ELD-----IA--------------------------W--------------------------DT--------ATNVGISVGRS----P--D--GTR----HTNIGKYGAD---------L-------YVDRGPSDLAGYS-LAPYS-R--AAAPI---D---P-GAR-----SVHLRIL-----VDTQSVEVFVNAGHTVLSQQVHFAE----G--D---TGISLYTDG---G-P--AHFTGIVVREIGQ----------------------------------------------------------------------------------------------------------------------------------------------------------------------
18 PsiBlast_PDB 78.8331% 17 - C3 -4FFH ? A:[4-480] --------------------------------------YHMTPPSGWLCNPQRPVT--TH--GA--YQLYYLHSDQNN--G-PGGWDHASTTDGVAFTHHGTVMPL-----R-P-----DFP-VWSGSAVVDTANTAGFGAG---A------VVALATQ-------------PT---D-------------GVRKY-------QEQY--LYWSTD----GGFTFTAL-P--DPVIVNTDGRAATTP-----------AE------I---ENAEWFRDPKIHWDTARGEWVCV--IGR-----L--R-----YAAFYTSPNLRDWTLR-RNFDYPN----HALGGI-ECPDLFEITADDG-------------TRHWVLAASMDAYGIG-----L-----PMTYAYWTGTWD--G--EQFHADD----L-----T-----PQ---WLDWGWDWYAAVTWPSIDAPETKRLAIAWMNNWKYAAR-DVP---TDASDGYNGQNSIVRELRLA-----RQ-----P-----GGWYTLLSTPV--A-----ALTNYVTATTTLP-DR--TVDGSA---VL-PWNGRAYEI--ELD-----IA--------------------------W--------------------------DT--------ATNVGISVGRS----P--D--GTR----HTNIGKYGAD---------L-------YVDRGPSDLAGYS-LAPYS-R--AAAPI---D---P-GAR-----SVHLRIL-----VDTQSVEVFVNAGHTVLSQQVHFAE----G--D---TGISLYTDG---G-P--AHFTGIVVREIGQ----------------------------------------------------------------------------------------------------------------------------------------------------------------------
36 PsiBlast_CBE 78.3331% 16 - C3 -4FFI ? B:[4-480] --------------------------------------YHMTPPSGWLCNPQRPVT--TH--GA--YQLYYLHSDQNN--G-PGGWDHASTTDGVAFTHHGTVMPL-----R-P-----DFP-VWSGSAVVDTANTAGFGAG---A------VVALATQ-------------PT---D-------------GVRKY-------QEQY--LYWSTD----GGFTFTAL-P--DPVIVNTDGRAATTP-----------AE------I---ENAEWFRDPKIHWDTARGEWVCV--IGR-----L--R-----YAAFYTSPNLRDWTLR-RNFDYPN----HALGGI-ECPDLFEITADDG-------------TRHWVLAASMDAYGIG-----L-----PMTYAYWTGTWD--G--EQFHADD----L-----T-----PQ---WLDWGWDWYAAVTWPSIDAPETKRLAIAWMNNWKYAAR-DVP---TDASDGYNGQNSIVRELRLA-----RQ-----P-----GGWYTLLSTPV--A-----ALTNYVTATTTLP-DR--TVDGSA---VL-PWNGRAYEI--ELD-----IA--------------------------W--------------------------DT--------ATNVGISVGRS----P--D--GTR----HTNIGKYGAD---------L-------YVDRGPSDLAGYS-LAPYS-R--AAAPI---D---P-GAR-----SVHLRIL-----VDTQSVEVFVNAGHTVLSQQVHFAE----G--D---TGISLYTDG---G-P--AHFTGIVVREIGQ----------------------------------------------------------------------------------------------------------------------------------------------------------------------
38 PsiBlast_CBE 78.3231% 14 - C3 -4FFH ? C:[4-480] --------------------------------------YHMTPPSGWLCNPQRPVT--TH--GA--YQLYYLHSDQNN--G-PGGWDHASTTDGVAFTHHGTVMPL-----R-P-----DFP-VWSGSAVVDTANTAGFGAG---A------VVALATQ-------------PT---D-------------GVRKY-------QEQY--LYWSTD----GGFTFTAL-P--DPVIVNTDGRAATTP-----------AE------I---ENAEWFRDPKIHWDTARGEWVCV--IGR-----L--R-----YAAFYTSPNLRDWTLR-RNFDYPN----HALGGI-ECPDLFEITADDG-------------TRHWVLAASMDAYGIG-----L-----PMTYAYWTGTWD--G--EQFHADD----L-----T-----PQ---WLDWGWDWYAAVTWPSIDAPETKRLAIAWMNNWKYAAR-DVP---TDASDGYNGQNSIVRELRLA-----RQ-----P-----GGWYTLLSTPV--A-----ALTNYVTATTTLP-DR--TVDGSA---VL-PWNGRAYEI--ELD-----IA--------------------------W--------------------------DT--------ATNVGISVGRS----P--D--GTR----HTNIGKYGAD---------L-------YVDRGPSDLAGYS-LAPYS-R--AAAPI---D---P-GAR-----SVHLRIL-----VDTQSVEVFVNAGHTVLSQQVHFAE----G--D---TGISLYTDG---G-P--AHFTGIVVREIGQ----------------------------------------------------------------------------------------------------------------------------------------------------------------------
2 PsiBlast_PDB 78.2641% 44 - C3 -1Y9G INUE_ASPAW A:[3-517] -----------------------------YDQPY-RGQYHFSPQKNWMNDPNGLLY--HN--GT--YHLFFQYNPGGIEWG-NISWGHAISEDLTHWEEKPVALLARGFGSD-V-----TEM-YFSGSAVADVNNTSGFGKD---GKTP---LVAMYTSYYPVAQTLPSGQTVQ---E-------------D---Q-------QSQS--IAYSLD----DGLTWTTYDA-ANPVIPN--------P-----------PSPYEAEYQ---N----FRDPFVFWHDESQKWVVVTSIAE-----L--H-----KLAIYTSDNLKDWKLV-SEFGP-Y----NAQGGVWECPGLVKLPLDSG------------NSTKWVITSGLNPGGPP-----GTV---GSGTQYFVGEFD--G--TTFTPDADTVYP-----G-----NSTANWMDWGPDFYAAAGYNGLSLND--HVHIGWMNNWQY-GA-NIP---TYP---WRSAMAIPRHMALK-----TI-----G-----SK-ATLVQQPQ--E-----AWSSISNKRPIYS-RT--FKTLSEGSTNT-TTTGETFKVDLSFS-----AK-----------------------------------------------------SK--------ASTFAIALRAS----A--NFTEQT----LVGYDFAKQQ---------I-------FLDRTHSGDVSFD-ETFASVY--H-GPL---T---PDSTG-----VVKLSIF-----VDRSSVEVFGGQGETTLTAQIFPSS----D--A---VHARLASTG---G-T--TEDVRADIYKIASTW--------------------------------------------------------------------------------------------------------------------------------------------------------------------
35 PsiBlast_CBE 78.1031% 17 - C3 -4FFI ? C:[4-480] --------------------------------------YHMTPPSGWLCNPQRPVT--TH--GA--YQLYYLHSDQNN--G-PGGWDHASTTDGVAFTHHGTVMPL-----R-P-----DFP-VWSGSAVVDTANTAGFGAG---A------VVALATQ-------------PT---D-------------GVRKY-------QEQY--LYWSTD----GGFTFTAL-P--DPVIVNTDGRAATTP-----------AE------I---ENAEWFRDPKIHWDTARGEWVCV--IGR-----L--R-----YAAFYTSPNLRDWTLR-RNFDYPN----HALGGI-ECPDLFEITADDG-------------TRHWVLAASMDAYGIG-----L-----PMTYAYWTGTWD--G--EQFHADD----L-----T-----PQ---WLDWGWDWYAAVTWPSIDAPETKRLAIAWMNNWKYAAR-DVP---TDASDGYNGQNSIVRELRLA-----RQ-----P-----GGWYTLLSTPV--A-----ALTNYVTATTTLP-DR--TVDGSA---VL-PWNGRAYEI--ELD-----IA--------------------------W--------------------------DT--------ATNVGISVGRS----P--D--GTR----HTNIGKYGAD---------L-------YVDRGPSDLAGYS-LAPYS-R--AAAPI---D---P-GAR-----SVHLRIL-----VDTQSVEVFVNAGHTVLSQQVHFAE----G--D---TGISLYTDG---G-P--AHFTGIVVREIGQ----------------------------------------------------------------------------------------------------------------------------------------------------------------------
39 PsiBlast_CBE 78.0931% 15 - C3 -4FFH ? B:[4-480] --------------------------------------YHMTPPSGWLCNPQRPVT--TH--GA--YQLYYLHSDQNN--G-PGGWDHASTTDGVAFTHHGTVMPL-----R-P-----DFP-VWSGSAVVDTANTAGFGAG---A------VVALATQ-------------PT---D-------------GVRKY-------QEQY--LYWSTD----GGFTFTAL-P--DPVIVNTDGRAATTP-----------AE------I---ENAEWFRDPKIHWDTARGEWVCV--IGR-----L--R-----YAAFYTSPNLRDWTLR-RNFDYPN----HALGGI-ECPDLFEITADDG-------------TRHWVLAASMDAYGIG-----L-----PMTYAYWTGTWD--G--EQFHADD----L-----T-----PQ---WLDWGWDWYAAVTWPSIDAPETKRLAIAWMNNWKYAAR-DVP---TDASDGYNGQNSIVRELRLA-----RQ-----P-----GGWYTLLSTPV--A-----ALTNYVTATTTLP-DR--TVDGSA---VL-PWNGRAYEI--ELD-----IA--------------------------W--------------------------DT--------ATNVGISVGRS----P--D--GTR----HTNIGKYGAD---------L-------YVDRGPSDLAGYS-LAPYS-R--AAAPI---D---P-GAR-----SVHLRIL-----VDTQSVEVFVNAGHTVLSQQVHFAE----G--D---TGISLYTDG---G-P--AHFTGIVVREIGQ----------------------------------------------------------------------------------------------------------------------------------------------------------------------
34 PsiBlast_CBE 78.0831% 14 - C3 -4FFI ? D:[4-479] --------------------------------------YHMTPPSGWLCNPQRPVT--TH--GA--YQLYYLHSDQNN--G-PGGWDHASTTDGVAFTHHGTVMPL-----R-P-----DFP-VWSGSAVVDTANTAGFGAG---A------VVALATQ-------------PT---D-------------GVRKY-------QEQY--LYWSTD----GGFTFTAL-P--DPVIVNTDGRAATTP-----------AE------I---ENAEWFRDPKIHWDTARGEWVCV--IGR-----L--R-----YAAFYTSPNLRDWTLR-RNFDYPN----HALGGI-ECPDLFEITADDG-------------TRHWVLAASMDAYGIG-----L-----PMTYAYWTGTWD--G--EQFHADD----L-----T-----PQ---WLDWGWDWYAAVTWPSIDAPETKRLAIAWMNNWKYAAR-DVP---TDASDGYNGQNSIVRELRLA-----RQ-----P-----GGWYTLLSTPV--A-----ALTNYVTATTTLP-DR--TVDGSA---VL-PWNGRAYEI--ELD-----IA--------------------------W--------------------------DT--------ATNVGISVGRS----P--D--GTR----HTNIGKYGAD---------L-------YVDRGPSDLAGYS-LAPYS-R--AAAPI---D---P-GAR-----SVHLRIL-----VDTQSVEVFVNAGHTVLSQQVHFAE----G--D---TGISLYTDG---G-P--AHFTGIVVREIG-----------------------------------------------------------------------------------------------------------------------------------------------------------------------