@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu28130: (2016-07-14 )
MSQSFNRHRRLRTSKAMREMVKETRLHPSDFIYPIFVVEGLEGKKAVPSMPDVHHVSLDLLKDEVAELVKLGIQSVIVFGIPEEKDDCGTQAYHDHGIVQKAITEIKEHFPEMVVVADTCLCEYTDHGHCGLVKDGVILNDESLELLAQTAVSQAKAGADIIAPSNMMDGFVTVIREALDKEGFVNIPIMSYAVKYSSEFYGPFRDAANSTPQFGDRKTYQMDPANRMEALREAQSDVEEGADFLIVKPSLSYMDIMRDVKNEFTLPLVAYNVSGEYSMVKAAAQNGWIKEKEIVLEILTSMKRAGADLIITYHAKDAAKWLAE

Atome Classification :

(38 SA) .........10........20........30........40........50........60........70........80--.--..---.--....-.90---.........100.......110.......120.......130..--..-.-...140.......150.......160.......170.......180...-.-..-.190.......200.......210...--....220.......230.......240.......250.......260.-.-.-....270.......280.......290.......300.......310.......320..
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MSQSFNRHRRLRTSKAMREMVKETRLHPSDFIYPIFVVEGLEGKKAVPSMPDVHHVSLDLLKDEVAELVKLGIQSVIVFG---I--PE---E--KDDC-GT----QAYHDHGIVQKAITEIKEHFPEMVVVADTCLCEYTDHGHCG-LV--KD-G-VILNDESLELLAQTAVSQAKAGADIIAPSNMMDGFVTVIREALDKEGFV-N-IP-IMSYAVKYSSEFYGPFRDAANSTPQFG--DRKTYQMDPANRMEALREAQSDVEEGADFLIVKPSLSYMDIMRDVKNE-F-T-LPLVAYNVSGEYSMVKAAAQNGWIKEKEIVLEILTSMKRAGADLIITYHAKDAAKWLAE
10 PsiBlast_PDB 82.8749%-110 - C8 -1L6Y HEM2_ECOLI A:[4-318] ----IQRPRRLRKSPALRAMFEETTLSLNDLVLPIFVEEEIDDYKAVEAMPGVMRIPEKHLAREIERIANAGIRSVMTFG---I--SH---H--TDET-GS----DAWREDGLVARMSRICKQTVPEMIVMSDTCFCEYTSHGHCG-VL--CE-H-GVDNDATLENLGKQAVVAAAAGADFIAPSAAMDGQVQAIRQALDAAGFK-D-TA-IMSYSTKFASSFYGPFREAAGSALK-G--DRKSYQMNPMNRREAIRESLLDEAQGADCLMVKPAGAYLDIVRELRER-T-E-LPIGAYQVSGEYAMIKFAALAGAIDEEKVVLESLGSIKRAGADLIFSYFALDLAE----
8 PsiBlast_PDB 82.7249%-106 - C8 -5IC2 ? A:[2-319] -TDLIQRPRRLRKSPALRAMFEETTLSLNDLVLPIFVEEEIDDYKAVEAMPGVMRIPEKHLAREIERIANAGIRSVMTFG---I--SH---H--TDET-GS----DAWREDGLVARMSRICKQTVPEMIVMSDTCFCEYTSHGHCG-VL--CE-H-GVDNDATLENLGKQAVVAAAAGADFIAPSAAMDGQVQAIRQALDAAGFK-D-TA-IMSYSTKFASSFYGPFREAAGSALK-G--DRKSYQMNPMNRREAIRESLLDEAQGADCLMVKPAGAYLDIVRELRER-T-E-LPIGAYQVSGEYAMIKFAALAGAIDEEKVVLESLGSIKRAGADLIFSYFALDLAE----
28 PsiBlast_CBE 82.6649%-104 - C8 -1I8J HEM2_ECOLI B:[4-318] ----IQRPRRLRKSPALRAMFEETTLSLNDLVLPIFVEEEIDDYKAVEAMPGVMRIPEKHLAREIERIANAGIRSVMTFG---I--SH---H--TDET-GS----DAWREDGLVARMSRICKQTVPEMIVMSDTCFCEYTSHGHCG-VL--CE-H-GVDNDATLENLGKQAVVAAAAGADFIAPSAAMDGQVQAIRQALDAAGFK-D-TA-IMSYSTKFASSFYGPFREAAGSALK-G--DRKSYQMNPMNRREAIRESLLDEAQGADCLMVKPAGAYLDIVRELRER-T-E-LPIGAYQVSGEYAMIKFAALAGAIDEEKVVLESLGSIKRAGADLIFSYFALDLAE----
60 HHSearch 82.4549%-105 - C8 -1L6S HEM2_ECOLI A:[1-321] -TDLIQRPRRLRKSPALRAMFEETTLSLNDLVLPIFVEEEIDDYKAVEAMPGVMRIPEKHLAREIERIANAGIRSVMTFG---I--SH---H--TDET-GS----DAWREDGLVARMSRICKQTVPEMIVMSDTCFCEYTSHGHCG-VL--CE-H-GVDNDATLENLGKQAVVAAAAGADFIAPSAAMDGQVQAIRQALDAAGFK-D-TA-IMSYSTKFASSFYGPFREAAGSAL-KG--DRKSYQMNPMNRREAIRESLLDEAQGADCLMVKPAGAYLDIVRELRER-T-E-LPIGAYQVSGEYAMIKFAALAGAIDEEKVVLESLGSIKRAGADLIFSYFALDLAEKKI-
9 PsiBlast_PDB 82.0849%-106 - C8 -1L6S HEM2_ECOLI A:[4-318] ----IQRPRRLRKSPALRAMFEETTLSLNDLVLPIFVEEEIDDYKAVEAMPGVMRIPEKHLAREIERIANAGIRSVMTFG---I--SH---H--TDET-GS----DAWREDGLVARMSRICKQTVPEMIVMSDTCFCEYTSHGHCG-VL--CE-H-GVDNDATLENLGKQAVVAAAAGADFIAPSAAMDGQVQAIRQALDAAGFK-D-TA-IMSYSTKFASSFYGPFREAAGSALK-G--DRKSYQMNPMNRREAIRESLLDEAQGADCLMVKPAGAYLDIVRELRER-T-E-LPIGAYQVSGEYAMIKFAALAGAIDEEKVVLESLGSIKRAGADLIFSYFALDLAE----
11 PsiBlast_PDB 82.0149%-104 - C8 -1I8J HEM2_ECOLI A:[4-318] ----IQRPRRLRKSPALRAMFEETTLSLNDLVLPIFVEEEIDDYKAVEAMPGVMRIPEKHLAREIERIANAGIRSVMTFG---I--SH---H--TDET-GS----DAWREDGLVARMSRICKQTVPEMIVMSDTCFCEYTSHGHCG-VL--CE-H-GVDNDATLENLGKQAVVAAAAGADFIAPSAAMDGQVQAIRQALDAAGFK-D-TA-IMSYSTKFASSFYGPFREAAGSALK-G--DRKSYQMNPMNRREAIRESLLDEAQGADCLMVKPAGAYLDIVRELRER-T-E-LPIGAYQVSGEYAMIKFAALAGAIDEEKVVLESLGSIKRAGADLIFSYFALDLAE----
7 PsiBlast_PDB 81.8449%-106 - C8 -1B4E HEM2_ECOLI A:[5-318] -----QRPRRLRKSPALRAMFEETTLSLNDLVLPIFVEEEIDDYKAVEAMPGVMRIPEKHLAREIERIANAGIRSVMTFG---I--SH---H--TDET-GS----DAWREDGLVARMSRICKQTVPEMIVMSDTCFCEYTSHGHCG-VL--KE-H-GVDNDATLENLGKQAVVAAAAGADFIAPSAAMDGQVQAIRQALDAAGFK-D-TA-IMSYSTKFASSFYGPFREAAGSALK-G--DRKSYQMNPMNRREAIRESLLDEAQGADCLMVKPAGAYLDIVRELRER-T-E-LPIGAYQVSGEYAMIKFAALAGAIDEEKVVLESLGSIKRAGADLIFSYFALDLAE----
59 HHSearch 81.4351%-117 * C8 *1W1Z HEM2_CHLP8 A:[10-328] ----VHRPRRLRRTAALRNLVQENTLTVNDLVFPLFVMPGTNAVEEVSSMPGSFRFTIDRAVEECKELYDLGIQGIDLFG---I--PE---Q--KTED-GS----EAYNDNGILQQAIRAIKKAVPELCIMTDVALDPFTPFGHDG-LV--KD-G-IILNDETVEVLQKMAVSHAEAGADFVSPSDMMDGRIGAIREALDETDHS-D-VG-ILSYAAKYASSFYGPFRDALHSAPQFG--DKSTYQMNPANTEEAMKEVELDIVEGADIVMVKPGLAYLDIVWRTKER-F-D-VPVAIYHVSGEYAMVKAAAAKGWIDEDRVMMESLLCMKRAGADIIFTYYAKEAAKKLR-
22 PsiBlast_CBE 80.6751%-118 - C8 -1W1Z HEM2_CHLP8 B:[25-327] -------------------LVQENTLTVNDLVFPLFVMPGTNAVEEVSSMPGSFRFTIDRAVEECKELYDLGIQGIDLFG---I--PE---Q--KTED-GS----EAYNDNGILQQAIRAIKKAVPELCIMTDVALDPFTPFGHDG-LV--KD-G-IILNDETVEVLQKMAVSHAEAGADFVSPSDMMDGRIGAIREALDETDHS-D-VG-ILSYAAKYASSFYGPFRDALHSAPQFG--DKSTYQMNPANTEEAMKEVELDIVEGADIVMVKPGLAYLDIVWRTKER-F-D-VPVAIYHVSGEYAMVKAAAAKGWIDEDRVMMESLLCMKRAGADIIFTYYAKEAAKKL--
21 PsiBlast_CBE 80.0151%-119 - C8 -2C1H HEM2_CHLP8 B:[25-327] -------------------LVQENTLTVNDLVFPLFVMPGTNAVEEVSSMPGSFRFTIDRAVEECKELYDLGIQGIDLFG---I--PE---Q--KTED-GS----EAYNDNGILQQAIRAIKKAVPELCIMTDVALDPFTPFGHDG-LV--KD-G-IILNDETVEVLQKMAVSHAEAGADFVSPSDMMDGRIGAIREALDETDHS-D-VG-ILSYAAKYASSFYGPFRDALHSAPQFG--DKSTYQMNPANTEEAMKEVELDIVEGADIVMVKPGLAYLDIVWRTKER-F-D-VPVAIYHVSGEYAMVKAAAAKGWIDEDRVMMESLLCMKRAGADIIFTYYAKEAAKKL--
2 PsiBlast_PDB 79.7351%-118 - C8 -2C1H HEM2_CHLP8 A:[25-327] -------------------LVQENTLTVNDLVFPLFVMPGTNAVEEVSSMPGSFRFTIDRAVEECKELYDLGIQGIDLFG---I--PE---Q--KTED-GS----EAYNDNGILQQAIRAIKKAVPELCIMTDVALDPFTPFGHDG-LV--KD-G-IILNDETVEVLQKMAVSHAEAGADFVSPSDMMDGRIGAIREALDETDHS-D-VG-ILSYAAKYASSFYGPFRDALHSAPQFG--DKSTYQMNPANTEEAMKEVELDIVEGADIVMVKPGLAYLDIVWRTKER-F-D-VPVAIYHVSGEYAMVKAAAAKGWIDEDRVMMESLLCMKRAGADIIFTYYAKEAAKKL--
1 PsiBlast_PDB 79.5251%-119 - C8 -1W1Z HEM2_CHLP8 A:[25-327] -------------------LVQENTLTVNDLVFPLFVMPGTNAVEEVSSMPGSFRFTIDRAVEECKELYDLGIQGIDLFG---I--PE---Q--KTED-GS----EAYNDNGILQQAIRAIKKAVPELCIMTDVALDPFTPFGHDG-LV--KD-G-IILNDETVEVLQKMAVSHAEAGADFVSPSDMMDGRIGAIREALDETDHS-D-VG-ILSYAAKYASSFYGPFRDALHSAPQFG--DKSTYQMNPANTEEAMKEVELDIVEGADIVMVKPGLAYLDIVWRTKER-F-D-VPVAIYHVSGEYAMVKAAAAKGWIDEDRVMMESLLCMKRAGADIIFTYYAKEAAKKL--
61 HHSearch 72.0046% -11 - C8 -3OBK ? A:[17-343] -LPIQARPRRNRKNRAVRQLVQENLVKPSSLIYPLFVHDEET-SVPIPSMPGQSRLSMEDLLKEVGEARSYGIKAFMLFP---K--VD---DELKSVM-AE----ESYNPDGLLPRAIMALKEAFPDVLLLADVALDPYSSMGHDG-VV--DEQSGKIVNDLTVHQLCKQAITLARAGADMVCPSDMMDGRVSAIRESLDMEGCT-D-TS-ILAYSCKYASSFYGPFRDALDSHMVGGT-DKKTYQMDPSNSREAEREAEADASEGADMLMVKPGLPYLDVLAKIREK-S-K-LPMVAYHVSGEYAMLKAAAEKGYISEKDTVLEVLKSFRRAGADAVATYYAKEAAKWMVE
5 PsiBlast_PDB 71.9446% -23 - C8 -1W56 HEM2_PSEAE A:[12-333] ----YTRLRRNRRDDFSRRLVRENVLTVDDLILPVFVLDGVNQRESIPSMPGVERLSIDQLLIEAEEWVALGIPALALFP---VT-PV---E--KKSLDAA----EAYNPEGIAQRATRALRERFPELGIITDVCLCPFTTHGQDG-IL--DDDG-YVLNDVSIDVLVRQALSHAEAGAQVVAPSDMMDGRIGAIREALESAGHT-N-VR-VMAYSAKYASAYYGPFRDAVGSASNLGKGNKATYQMDPANSDEALHEVAADLAEGADMVMVKPGMPYLDIVRRVKDE-F-R-APTFVYQVSGEYAMHMGAIQNGWLAES-VILESLTAFKRAGADGILTYFAKQAAEQL--
3 PsiBlast_PDB 71.8247% -24 - C8 -1W5O HEM2_PSEAE A:[12-333] ----YTRLRRNRRDDFSRRLVRENVLTVDDLILPVFVLDGVNQRESIPSMPGVERLSIDQLLIEAEEWVALGIPALALFP---VT-PV---E--KKSLDAA----EAYNPEGIAQRATRALRERFPELGIITDVCLCPFTTHGQCG-IL--DDDG-YVLNDVSIDVLVRQALSHAEAGAQVVAPSDMMDGRIGAIREALESAGHT-N-VR-VMAYSAKYASAYYGPFRDAVGSASNLGKGNKATYQMDPANSDEALHEVAADLAEGADMVMVKPGMPYLDIVRRVKDE-F-R-APTFVYQVSGEYAMHMGAIQNGWLAES-VILESLTAFKRAGADGILTYFAKQAAEQL--
4 PsiBlast_PDB 71.6946% -25 - C8 -1W5N HEM2_PSEAE A:[12-333] ----YTRLRRNRRDDFSRRLVRENVLTVDDLILPVFVLDGVNQRESIPSMPGVERLSIDQLLIEAEEWVALGIPALALFP---VT-PV---E--KKSLDAA----EAYNPEGIAQRATRALRERFPELGIITDVALCPFTTHGQCG-IL--DDDG-YVLNDVSIDVLVRQALSHAEAGAQVVAPSDMMDGRIGAIREALESAGHT-N-VR-VMAYSAKYASAYYGPFRDAVGS-------NKATYQMDPANSDEALHEVAADLAEGADMVMVKPGMPYLDIVRRVKDE-F-R-APTFVYQVSGEYAMHMGAIQNGWLAES-VILESLTAFKRAGADGILTYFAKQAAEQL--
34 PsiBlast_CBE 71.6646% -20 - C8 -3OBK ? C:[22-343] ------RPRRNRKNRAVRQLVQENLVKPSSLIYPLFVHDE-ETSVPIPSMPGQSRLSMEDLLKEVGEARSYGIKAFMLF-------PK---V--DDEL-KSVMAEESYNPDGLLPRAIMALKEAFPDVLLLADVALDPYSSMGHDG-VVDEQS-G-KIVNDLTVHQLCKQAITLARAGADMVCPSDMMDGRVSAIRESLDMEGCT-D-TS-ILAYSCKYASSFYGPFRDALDSHMVGGT-DKKTYQMDPSNSREAEREAEADASEGADMLMVKPGLPYLDVLAKIREK-S-K-LPMVAYHVSGEYAMLKAAAEKGYISEKDTVLEVLKSFRRAGADAVATYYAKEAAKWMVE
42 PsiBlast_CBE 71.6544% -29 - C8 -1W31 HEM2_YEAST A:[27-340] ----------------LRQWQSERQLTKNMLIFPLFISDNPDDFTEIDSLPNINRIGVNRLKDYLKPLVAKGLRSVILFGVPLI--PG---T--KDPV-GT----AADDPAGPVIQGIKFIREYFPELYIICDVCLCEYTSHGHCGVLY--DD-G-TINRERSVSRLAAVAVNYAKAGAHCVAPSDMIDGRIRDIKRGLINANLA-H-KTFVLSYAAKFSGNLYGPFRDAACSAPSNG--DRKCYQLPPAGRGLARRALERDMSEGADGIIVKPSTFYLDIMRDASEI-C-KDLPICAYHVSGEYAMLHAAAEKGVVDLKTIAFESHQGFLRAGARLIITYLAPEFLDWLDE
41 PsiBlast_CBE 71.6344% -30 - C8 -1H7O HEM2_YEAST A:[27-340] ----------------LRQWQSERQLTKNMLIFPLFISDNPDDFTEIDSLPNINRIGVNRLKDYLKPLVAKGLRSVILFGVPLI--PG---T--KDPV-GT----AADDPAGPVIQGIKFIREYFPELYIICDVCLCEYTSHGHCGVLY--DD-G-TINRERSVSRLAAVAVNYAKAGAHCVAPSDMIDGRIRDIKRGLINANLA-H-KTFVLSYAAKFSGNLYGPFRDAACSAPSNG--DRKCYQLPPAGRGLARRALERDMSEGADGIIVKPSTFYLDIMRDASEI-C-KDLPICAYHVSGEYAMLHAAAEKGVVDLKTIAFESHQGFLRAGARLIITYLAPEFLDWLDE
40 PsiBlast_CBE 71.6044% -32 - C8 -1EB3 HEM2_YEAST A:[27-340] ----------------LRQWQSERQLTKNMLIFPLFISDNPDDFTEIDSLPNINRIGVNRLKDYLKPLVAKGLRSVILFGVPLI--PG---T--KDPV-GT----AADDPAGPVIQGIKFIREYFPELYIICDVCLCEYTSHGHCGVLY--DD-G-TINRERSVSRLAAVAVNYAKAGAHCVAPSDMIDGRIRDIKRGLINANLA-H-KTFVLSYAAKFSGNLYGPFRDAACSAPSNG--DRKCYQLPPAGRGLARRALERDMSEGADGIIVKPSTFYLDIMRDASEI-C-KDLPICAYHVSGEYAMLHAAAEKGVVDLKTIAFESHQGFLRAGARLIITYLAPEFLDWLDE
47 PsiBlast_CBE 71.5844% -30 - C8 -1H7P HEM2_YEAST A:[27-340] ----------------LRQWQSERQLTKNMLIFPLFISDNPDDFTEIDSLPNINRIGVNRLKDYLKPLVAKGLRSVILFGVPLI--PG---T--KDPV-GT----AADDPAGPVIQGIKFIREYFPELYIICDVCLCEYTSHGHCGVLY--DD-G-TINRERSVSRLAAVAVNYAKAGAHCVAPSDMIDGRIRDIKRGLINANLA-H-KTFVLSYAAKFSGNLYGPFRDAACSAPSNG--DRKCYQLPPAGRGLARRALERDMSEGADGIIVKPSTFYLDIMRDASEI-C-KDLPICAYHVSGEYAMLHAAAEKGVVDLKTIAFESHQGFLRAGARLIITYLAPEFLDWLDE
25 PsiBlast_CBE 71.2446% -24 - C8 -1W5N HEM2_PSEAE B:[12-333] ----YTRLRRNRRDDFSRRLVRENVLTVDDLILPVFVLDGVNQRESIPSMPGVERLSIDQLLIEAEEWVALGIPALALFP---VT-PV---E--KKSLDAA----EAYNPEGIAQRATRALRERFPELGIITDVALCPFTTHGQCG-IL--DDDG-YVLNDVSIDVLVRQALSHAEAGAQVVAPSDMMDGRIGAIREALESAGHT-N-VR-VMAYSAKYASAYYGPFRDAVGS-------NKATYQMDPANSDEALHEVAADLAEGADMVMVKPGMPYLDIVRRVKDE-F-R-APTFVYQVSGEYAMHMGAIQNGWLAES-VILESLTAFKRAGADGILTYFAKQAAEQL--
6 PsiBlast_PDB 71.1546% -18 - C8 -1W5M HEM2_PSEAE A:[12-333] ----YTRLRRNRRDDFSRRLVRENVLTVDDLILPVFVLDGVNQRESIPSMPGVERLSIDQLLIEAEEWVALGIPALALFP---VT-PV---E--KKSLDAA----EAYNPEGIAQRATRALRERFPELGIITDVCLDPFTTHGQCG-IL--DDDG-YVLNDVSIDVLVRQALSHAEAGAQVVAPSDMMDGRIGAIREALESAGHT-N-VR-VMAYSAKYASAYYGPFRDAVGSASNLGKGNKATYQMDPANSDEALHEVAADLAEGADMVMVKPGMPYLDIVRRVKDE-F-R-APTFVYQVSGEYAMHMGAIQNGWLAES-VILESLTAFKRAGADGILTYFAKQAAEQL--