@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu29080: (2016-07-16 )
MPELPEVETVRRTLTGLVKGKTIKSVEIRWPNIIKRPAEPEEFARKLAGETIQSIGRRGKFLLFHLDHYVMVSHLRMEGKYGLHQAEEPDDKHVHVIFTMTDGTQLRYRDVRKFGTMHLFKPGEEAGELPLSQLGPEPDAEEFTSAYLKDRLAKTNRAVKTALLDQKTVVGLGNIYVDEALFRAGVHPETKANQLSDKTIKTLHAEIKNTLQEAIDAGGSTVRSYINSQGEIGMFQLQHFVYGKKDEPCKNCGTMISKIVVGGRGTHFCAKCQTKK

Atome Classification :

(68 SA) .........10........20..-----......30.-.......40........50........60.....-.-------.-.70........80........90........100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210..--.....220..---.....230.......240.......-250.-........260.......270....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MPELPEVETVRRTLTGLVKGKTI-----KSVEIRWPN-IIKRPAEPEEFARKLAGETIQSIGRRGKFLLFHL-D-------H-YVMVSHLRMEGKYGLHQAEEPDDKHVHVIFTMTDGTQLRYRDVRKFGTMHLFKPGEEAGELPLSQLGPEPDAEEFTSAYLKDRLAKTNRAVKTALLDQKTVVGLGNIYVDEALFRAGVHPETKANQLSDKTIKTLHAEIKNTLQEA--IDAGGSTVRS---YINSQGEIGMFQLQHFVYGKKDEPC-K--N-CGTMISKIVVGGRGTHFCAKCQTKK
12 PsiBlast_PDB 85.7755% -77 - C8 -2F5S ? A:[2-273] -PQLPEVETIRRTLLPLIVGKTI-----EDVRIFWPN-IIRHPRDSEAFAARMIGQTVRGLERRGKFLKFLL-D-------R-DALISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDCTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEA--VMKGGSTVRT---YVNTQGEAGTFQHHLYVYGRQGNPC-K--R-CGTPIEKTVVAGRGTHYCPRCQ---
18 PsiBlast_PDB 85.5655% -79 - C8 -3GPY ? A:[1-272] -PQLPEVETIRRTLLPLIVGKTI-----EDVRIFWPN-IIRHPRDSEAFAARMIGQTVRGLERRGKFLKFLL-D-------R-DALISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDCTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEA--VMKGGSTVRT---YVNTQGEAGTFQHHLYVYGRQGNPC-K--R-CGTPIEKTVVAGRGTHYCPRCQ---
19 PsiBlast_PDB 85.0655% -77 - C8 -3GQ4 ? A:[1-272] -PQLPEVETIRRTLLPLIVGKTI-----EDVRIFWPN-IIRHPRDSEAFAARMIGQTVRGLERRGKFLKFLL-D-------R-DALISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDCTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEA--VMKGGSTVRT---YVNTQGEAGTFQHHLYVYGRQGNPC-K--R-CGTPIEKTVVAGRGTHYCPRCQ---
4 PsiBlast_PDB 85.0256% -84 - C8 -1L2C ? A:[2-273] -PELPEVETIRRTLLPLIVGKTI-----EDVRIFWPN-IIRHPRDSEAFAARMIGQTVRGLERRGKFLKFLL-D-------R-DALISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDQTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEA--VMKGGS-----------------FQHHLYVYGRQGNPC-K--R-CGTPIEKTVVAGRGTHYCPRCQ---
7 PsiBlast_PDB 84.9655% -78 - C8 -1R2Z ? A:[2-273] -PQLPEVETIRRTLLPLIVGKTI-----EDVRIFWPN-IIRHPRDSEAFAARMIGQTVRGLERRGKFLKFLL-D-------R-DALISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDQTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEA--VMKGGSTVRT---YVNTQGEAGTFQHHLYVYGRQGNPC-K--R-CGTPIEKTVVAGRGTHYCPRCQ---
36 PsiBlast_CBE 84.8854% -93 - C8 -3U6E ? A:[1-272] -PQLPEVETIRRTLLPLIVGKTI-----EDVRIFWPN-IIRHPRDSEAFAARMIGQTVRGLERRGKFLKFLL-D-------R-DALISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDCTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEA--VM------------------------HLYVYGRQGNPC-K--R-CGTPIEKTVVAGRGTHYCPRCQ---
25 PsiBlast_CBE 84.7155% -97 - C8 -3SAW ? A:[1-272] -PELPEVETIRRTLLPLIVGKTI-----EDVRIFWPN-IIRHPRDSEAFAARMIGQTVRGLERRGKFLKFLL-D-------R-DALISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVAKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDCTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEA--VM------------------------HLYVYGRQGNPC-K--R-CGTPIEKTVVAGRGTHYCPRCQ---
23 PsiBlast_CBE 84.6555% -93 - C8 -3SBJ ? A:[1-272] -PELPEVETIRRTLLPLIVGKTI-----EDVRIFWPN-IIRHPRDSEAFAARMIGQTVRGLERRGKFLKFLL-D-------R-DALISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDCTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEA--VM------------------------HLYVYGRQGNPC-K--R-CGTPIEKTVVAGRGTHYCPRCQ---
6 PsiBlast_PDB 84.5955% -77 - C8 -1R2Y ? A:[2-273] -PQLPEVETIRRTLLPLIVGKTI-----EDVRIFWPN-IIRHPRDSEAFAARMIGQTVRGLERRGKFLKFLL-D-------R-DALISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDQTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEA--VMKGGSTVRT---YVNTQGEAGTFQHHLYVYGRQGNPC-K--R-CGTPIEKTVVAGRGTHYCPRCQ---
1 PsiBlast_PDB 84.5956% -84 - C8 -1L1T ? A:[2-273] -PELPEVETIRRTLLPLIVGKTI-----EDVRIFWPN-IIRHPRDSEAFAARMIGQTVRGLERRGKFLKFLL-D-------R-DALISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDQTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEA--VMKGGS-----------------FQHHLYVYGRQGNPC-K--R-CGTPIEKTVVAGRGTHYCPRCQ---
39 PsiBlast_CBE 84.5154% -91 - C8 -4G4R ? A:[1-272] -PQLPEVETIRRTLLPLIVGKTI-----EDVRIFWPN-IIRHPRDSEAFAARMIGQTVRGLERRGKFLKFLL-D-------R-DALISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKAGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDCTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEA--VM------------------------HLYVYGRQGNPC-K--R-CGTPIEKTVVAGRGTHYCPRCQ---
11 PsiBlast_PDB 84.4855% -74 - C8 -2F5Q ? A:[2-273] -PQLPEVETIRRTLLPLIVGKTI-----EDVRIFWPN-IIRHPRDSEAFAARMIGQTVRGLERRGKFLKFLL-D-------R-DALISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDCTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEA--VMKGGSTVRT---YVNTQGEAGTFQHHLYVYGRQGNPC-K--R-CGTPIEKTVVAGRGTHYCPRCQ---
69 HHSearch 84.4155% -93 - C8 -3U6P ? A:[1-273] -PQLPEVETIRRTLLPLIVGKTI-----EDVRIFWPN-IIRHPRDSEAFAARMIGQTVRGLERRGKFLKFLL-D-------R-DALISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDCTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEA--VM------------------------HLYVYGRQGNPC-K--R-CGTPIEKTVVAGRGTHYCPRCQR--
29 PsiBlast_CBE 84.4154% -93 - C8 -4G4O ? A:[1-272] -PQLPEVETIRRTLLPLIVGKTI-----EDVRIFWPN-IIRHPRDSEAFAARMIGQTVRGLERRGKFLKFLL-D-------R-DALISHLRAEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDCTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEA--VM------------------------HLYVYGRQGNPC-K--R-CGTPIEKTVVAGRGTHYCPRCQ---
5 PsiBlast_PDB 84.3356% -81 - C8 -1L2D ? A:[2-273] -PELPEVETIRRTLLPLIVGKTI-----EDVRIFWPN-IIRHPRDSEAFAARMIGQTVRGLERRGKFLKFLL-D-------R-DALISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDQTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEA--VMKGGS-----------------FQHHLYVYGRQGNPC-K--R-CGTPIEKTVVAGRGTHYCPRCQ---
21 PsiBlast_CBE 84.2055% -79 - C8 -3JR5 ? A:[1-272] -PQLPEVETIRRTLLPLIVGKTI-----EDVRIFWPN-IIRHPRDSEAFAARMIGQTVRGLERRGKFLKFLL-D-------R-DALISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDQTVVAGFGCIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEA--VMKGGSTVRT---YVNTQGEAGTFQHHLYVYGRQGNPC-K--R-CGTPIEKTVVAGRGTHYCPRCQ---
3 PsiBlast_PDB 84.1656% -79 - C8 -1L2B ? A:[2-273] -PELPEVETIRRTLLPLIVGKTI-----EDVRIFWPN-IIRHPRDSEAFAARMIGQTVRGLERRGKFLKFLL-D-------R-DALISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDQTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEA--VMKGGSTVR------------GTFQHHLYVYGRQGNPC-K--R-CGTPIEKTVVAGRGTHYCPRCQ---
15 PsiBlast_PDB 84.0955% -93 - C8 -3SAV ? A:[1-272] -PELPEVETIRRTLLPLIVGKTI-----EDVRIFWPN-IIRHPRDSEAFAARMIGQTVRGLERRGKFLKFLL-D-------R-DALISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDCTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEA--VM------------------------HLYVYGRQGNPC-K--R-CGTPIEKTVVAGRGTHYCPRCQ---
31 PsiBlast_CBE 84.0854% -96 - C8 -3U6Q ? A:[1-272] -PQLPEVETIRRTLLPLIVGKTI-----EDVRIFWPN-IIRHPRDSEAFAARMIGQTVRGLERRGKFLKFLL-D-------R-DALISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDCTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEA--VM------------------------HLYVYGRQGNPC-K--R-CGTPIEKTVVAGRGTHYCPRCQ---
2 PsiBlast_PDB 84.0356% -84 - C8 -1L1Z ? A:[2-273] -PELPEVETIRRTLLPLIVGKTI-----EDVRIFWPN-IIRHPRDSEAFAARMIGQTVRGLERRGKFLKFLL-D-------R-DALISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDQTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEA--VMKGGSTV-------------GTFQHHLYVYGRQGNPC-K--R-CGTPIEKTVVAGRGTHYCPRCQ---
32 PsiBlast_CBE 83.9754% -94 - C8 -3U6P ? A:[1-272] -PQLPEVETIRRTLLPLIVGKTI-----EDVRIFWPN-IIRHPRDSEAFAARMIGQTVRGLERRGKFLKFLL-D-------R-DALISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDCTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEA--VM------------------------HLYVYGRQGNPC-K--R-CGTPIEKTVVAGRGTHYCPRCQ---
90 Fugue 83.8955% -83 - C8 -1L1Z ? A:[2-274] -PELPEVETIRRTLLPLIVGKTI-----EDVRIFWPN-IIRHPRDSEAFAARMIGQTVRGLERRGKFLKFLL-D-------R-DALISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDQTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEA--VMKGGSTV-------------GTFQHHLYVYGRQGNPC-K--R-CGTPIEKTVVAGRGTHYCPRCQR--
24 PsiBlast_CBE 83.8555% -94 - C8 -3GP1 ? A:[1-272] -PELPEVETIRRTLLPLIVGKTI-----EDVRIFWPN-IIRHPRDSEAFAARMIGQTVRGLERRGKFLKFLL-D-------R-DALISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDCTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEA--VM------------------------HLYVYGRQGNPC-K--R-CGTPIEKTVVAGRGTHYCPRCQ---
37 PsiBlast_CBE 83.8254% -94 - C8 -3U6D ? A:[1-272] -PQLPEVETIRRTLLPLIVGKTI-----EDVRIFWPN-IIRHPRDSEAFAARMIGQTVRGLERRGKFLKFLL-D-------R-DALISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDCTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEA--VM------------------------HLYVYGRQGNPC-K--R-CGTPIEKTVVAGRGTHYCPRCQ---
9 PsiBlast_PDB 83.8155% -95 - C8 -2F5O ? A:[2-273] -PELPEVETIRRTLLPLIVGKTI-----EDVRIFWPN-IIRHPRDSEAFAARMIGQTVRGLERRGKFLKFLL-D-------R-DALISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDCTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEA--VM------------------------HLYVYGRQGNPC-K--R-CGTPIEKTVVAGRGTHYCPRCQ---
14 PsiBlast_PDB 83.8055% -97 - C8 -3SAU ? A:[1-272] -PELPEVETIRRTLLPLIVGKTI-----EDVRIFWPN-IIRHPRDSEAFAARMIGQTVRGLERRGKFLKFLL-D-------R-DALISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDCTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEA--VM-------------------------LYVYGRQGNPC-K--R-CGTPIEKTVVAGRGTHYCPRCQ---
38 PsiBlast_CBE 83.7654% -91 - C8 -3U6C ? A:[1-272] -PQLPEVETIRRTLLPLIVGKTI-----EDVRIFWPN-IIRHPRDSEAFAARMIGQTVRGLERRGKFLKFLL-D-------R-DALISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDCTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEA--VM------------------------HLYVYGRQGNPC-K--R-CGTPIEKTVVAGRGTHYCPRCQ---
17 PsiBlast_PDB 83.7355% -96 - C8 -3GQ5 ? A:[1-272] -PELPEVETIRRTLLPLIVGKTI-----EDVRIFWPN-IIRHPRDSEAFAARMIGQTVRGLERRGKFLKFLL-D-------R-DALISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDCTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEA--VM------------------------HLYVYGRQGNPC-K--R-CGTPIEKTVVAGRGTHYCPRCQ---
34 PsiBlast_CBE 83.7054% -93 - C8 -3U6M ? A:[1-272] -PQLPEVETIRRTLLPLIVGKTI-----EDVRIFWPN-IIRHPRDSEAFAARMIGQTVRGLERRGKFLKFLL-D-------R-DALISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDCTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEA--VM------------------------HLYVYGRQGNPC-K--R-CGTPIEKTVVAGRGTHYCPRCQ---
33 PsiBlast_CBE 83.6354% -94 - C8 -3U6O ? A:[1-272] -PQLPEVETIRRTLLPLIVGKTI-----EDVRIFWPN-IIRHPRDSEAFAARMIGQTVRGLERRGKFLKFLL-D-------R-DALISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDCTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEA--VM------------------------HLYVYGRQGNPC-K--R-CGTPIEKTVVAGRGTHYCPRCQ---
30 PsiBlast_CBE 83.5954% -97 - C8 -3U6S ? A:[1-272] -PQLPEVETIRRTLLPLIVGKTI-----EDVRIFWPN-IIRHPRDSEAFAARMIGQTVRGLERRGKFLKFLL-D-------R-DALISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDCTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEA--VM------------------------HLYVYGRQGNPC-K--R-CGTPIEKTVVAGRGTHYCPRCQ---