@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu29710: (2016-07-18 )
MRDSVFIYSPSYQTYMFHQEHPFNQQRVLLTYDLLKTINAFDDGDIVTPRLASEEELSLVHTDDYIQAVKLAGAGKLPAEEGESYGLGTEDTPVFAGMHEAASLLVGGTLTAADWVMSGQALHAANLGGGLHHGFRGRASGFCIYNDSAVAIQYIQKKYSARVLYIDTDAHHGDGVQFTFYDNPDVCTLSIHETGRYLFPGTGQIQEKGSGKGYGYSFNIPLDAFTEDDSFLEAYRTAASEVAAYFEPDVIISQNGADAHYYDPLTHLSATINIYEEIPRLAHTLAHQYCGGKWIAVGGGGYDIWRVVPRAWARIWLEMKGIDPGHEIPPEWIVKWQKQCPVALPSSWSDPADLYPPIPRKPEITEKNAQTVSKALYAIRSEQQRTK

Atome Classification :

(85 SA) .........10........20........30........40........50........60........-70...-..-..--.--80-.........90........100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200-........210.......220.......230.......240.......250.......260.......270------.......----.280.......290.....-..300.......310.......320.......330........340.......350.......360.......370.......380.....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MRDSVFIYSPSYQTYMFHQEHPFNQQRVLLTYDLLKTINAFDDGDIVTPRLASEEELSLVHTDDYIQAV-KLAGA-GK-LP--A--E--EGESYGLGTEDTPVFAGMHEAASLLVGGTLTAADWVMSGQALHAANLGGGLHHGFRGRASGFCIYNDSAVAIQYIQKKYSARVLYIDTDAHHGDGVQFTFYDNPDVCTLSIHETGRYLFP-G-TGQIQEKGSGKGYGYSFNIPLDAFTEDDSFLEAYRTAASEVAAYFEPDVIISQNGADAHYYDPLTHLSAT-------INIYEEI----PRLAHTLAHQYCGGKWIAV-GGGGYDIWRVVPRAWARIWLEMKGIDPGHEIPP-EWIVKWQKQCPVALPSSWSDPADLYPPIPRKPEITEKNAQTVSKALYAIRSEQQRTK
102 Fugue 89.0529% -37 - C2 -4QA5 HDAC8_HUMAN A:[14-377] -LVPVYIYSPEYVSMCDSLAKI--PKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHL-QKVSQEGD-DD--H--P--DSIEYGLGY-DCPATEGIFDYAAAIGGATITAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFE-RILYVDLDLHHGDGVEDTFSFTSKVMTVSLHKFSPGFFP-G-TGDVSDVGLGKGRYYSVNVPIQDGIQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMT-------------P----VGIGKCLKYILQWQLATLILGGGGFNLANTA-RCWTYLTGVILGKTLSSEIPDHEFFTAY--------------GPDYVLEITPSCRPDRNEPHRIQQILNYIKGNLKHVV
86 PsiBlast_CBE 87.7831% -51 - C2 -5DC7 HDAC8_HUMAN B:[17-330] ----VYIYSPEYVSMC--DSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQE-GD-DD--H--P--DSIEYGLGY-DCPATEGIFDYAAAIGGATITAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFE-RILYVALDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFP-G-TGDVSDVGLGKGRYYSVNVPIQDGIQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTP------VGIGK-------CLKYILQWQL---ATLIL-GGGGFNLANT-----ARCWTYLTGVILGKTLSS-E--------------------------------------------------------
90 PsiBlast_CBE 87.2032% -46 - C2 -4QA0 HDAC8_HUMAN B:[17-330] ----VYIYSPEYVSMC--DSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQE-GD-DD--H--P--DSIEYGLGY-DCPATEGIFDYAAAIGGATITAAQCLIDGMCKVAINWSGGWHHAKKDEASGFFYLNDAVLGILRLRRKFE-RILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFP-G-TGDVSDVGLGKGRYYSVNVPIQDGIQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTP------VGIGK-------CLKYILQWQL---ATLIL-GGGGYNLANT-----ARCWTYLTGVILGKTLSS-E--------------------------------------------------------
17 PsiBlast_PDB 87.1932% -49 - C2 -3F0R HDAC8_HUMAN A:[17-330] ----VYIYSPEYVSMC--DSL--IPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQE-GD-DD--H--P--DSIEYGLGY-DCPATEGIFDYAAAIGGATITAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFE-RILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFP-G-TGDVSDVGLGKGRYYSVNVPIQDGIQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTP------VGIGK-------CLKYILQWQL---ATLIL-GGGGYNLANT-----ARCWTYLTGVILGKTLSS-E--------------------------------------------------------
114 HHSearch 87.0535% -26 - C2 -1C3P - ? A:[2-333] -KKVKLIGTLDYGKYRYPKNHPLKIPRVSLLLRFKDAMNLIDEKELIKSRPATKEELLLFHTEDYINTL-MEAER-CQ-CV--PK-G--AREKYNIGGYENPVSYAMFTGSSLATGSTVQAIEEFLKG--NVAFNPAGGMHHAFKSRANGFCYINNPAVGIEYLRKKGFKRILYIDLDAHHCDGVQEAFYDTDQVFVLSLHQSPEYAFP-FEKGFLEEIGEGKGKGYNLNIPLPKGLNDNEFLFALEKSLEIVKEVFEPEVYLLQLGTDPLLEDYLSKFNLS-------NVAFLKA----FNIVREV-----FGEGVYL-GGGGYH-PYALARAWTLIWCELSGREVPEKLNN-KAKELLKSI------------------------------------------------
83 PsiBlast_CBE 86.8232% -46 - C2 -3EWF HDAC8_HUMAN C:[17-330] ----VYIYSPEYVSMC--DSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQE-GD-DD--H--P--DSIEYGLGY-DCPATEGIFDYAAAIGGATITAAQCLIDGMCKVAINWSGGWHAAKKDEASGFCYLNDAVLGILRLRRKFE-RILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFP-G-TGDVSDVGLGKGRYYSVNVPIQDGIQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTP------VGIGK-------CLKYILQWQL---ATLIL-GGGGYNLANT-----ARCWTYLTGVILGKTLSS-E--------------------------------------------------------
11 PsiBlast_PDB 86.7532% -46 - C2 -4QA4 HDAC8_HUMAN A:[17-330] ----VYIYSPEYVSMC--DSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQE-GD-DD--H--P--DSIEYGLGY-DCPATEGIFDYAAAIGGATITAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFE-RILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFP-G-TGDVSDVGLGKGRYYSVNVPIQDGIQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTP------VGIGK-------CLKYILQWQL---ATLIL-GGGGYNLANT-----ARCWTYLTGVILGKTLSS-E--------------------------------------------------------
61 PsiBlast_CBE 86.5532% -45 - C2 -2V5W HDAC8_HUMAN B:[17-330] ----VYIYSPEYVSMC--DSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQE-GD-DD--H--P--DSIEYGLGY-DCPATEGIFDYAAAIGGATITAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFE-RILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFP-G-TGDVSDVGLGKGRYYSVNVPIQDGIQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTP------VGIGK-------CLKYILQWQL---ATLIL-GGGGFNLANT-----ARCWTYLTGVILGKTLSS-E--------------------------------------------------------
60 PsiBlast_CBE 86.4232% -48 - C2 -4QA7 HDAC8_HUMAN A:[17-330] ----VYIYSPEYVSMC--DSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQE-GD-DD--H--P--DSIEYGLGY-DCPATEGIFDYAAAIGGATITAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFE-RILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFP-G-TGDVSDVGLGKGRYYSVNVPIQDGIQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTP------VGIGK-------CLKYILQWQL---ATLIL-GGGGFNLANT-----ARCWTYLTGVILGKTLSS-E--------------------------------------------------------
84 PsiBlast_CBE 86.2632% -45 - C2 -3EWF HDAC8_HUMAN B:[17-330] ----VYIYSPEYVSMC--DSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQE-GD-DD--H--P--DSIEYGLGY-DCPATEGIFDYAAAIGGATITAAQCLIDGMCKVAINWSGGWHAAKKDEASGFCYLNDAVLGILRLRRKFE-RILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFP-G-TGDVSDVGLGKGRYYSVNVPIQDGIQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTP------VGIGK-------CLKYILQWQL---ATLIL-GGGGYNLANT-----ARCWTYLTGVILGKTLSS-E--------------------------------------------------------
91 PsiBlast_CBE 86.2332% -45 * C2 *4QA0 HDAC8_HUMAN A:[17-330] ----VYIYSPEYVSMC--DSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQE-GD-DD--H--P--DSIEYGLGY-DCPATEGIFDYAAAIGGATITAAQCLIDGMCKVAINWSGGWHHAKKDEASGFFYLNDAVLGILRLRRKFE-RILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFP-G-TGDVSDVGLGKGRYYSVNVPIQDGIQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTP------VGIGK-------CLKYILQWQL---ATLIL-GGGGYNLANT-----ARCWTYLTGVILGKTLSS-E--------------------------------------------------------
44 PsiBlast_CBE 86.2332% -42 - C2 -4QA2 HDAC8_HUMAN B:[17-330] ----VYIYSPEYVSMC--DSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQE-GD-DD--H--P--DSIEYGLGY-DCPATEGIFDYAAAIGGATITAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFE-RILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFP-G-TGDVSDVGLGKGRYYSVNVPIQDGIQDEKYYQNCESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTP------VGIGK-------CLKYILQWQL---ATLIL-GGGGYNLANT-----ARCWTYLTGVILGKTLSS-E--------------------------------------------------------
43 PsiBlast_CBE 86.1732% -44 - C2 -1T64 HDAC8_HUMAN B:[17-330] ----VYIYSPEYVSMC--DSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQE-GD-DD--H--P--DSIEYGLGY-DCPATEGIFDYAAAIGGATITAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFE-RILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFP-G-TGDVSDVGLGKGRYYSVNVPIQDGIQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTP------VGIGK-------CLKYILQWQL---ATLIL-GGGGYNLANT-----ARCWTYLTGVILGKTLSS-E--------------------------------------------------------
28 PsiBlast_CBE 86.1032% -42 - C2 -4QA1 HDAC8_HUMAN D:[17-330] ----VYIYSPEYVSMC--DSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQE-GD-DD--H--P--DSIEYGLGY-DCPATEGIFDYAAAIGGATITAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFE-RILYVDLDLHHGDGVEDTFSFTSKVMTVSLHKFSPGFFP-G-TGDVSDVGLGKGRYYSVNVPIQDGIQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTP------VGIGK-------CLKYILQWQL---ATLIL-GGGGYNLANT-----ARCWTYLTGVILGKTLSS-E--------------------------------------------------------
57 PsiBlast_CBE 86.0132% -45 - C2 -5D1C HDAC8_HUMAN A:[17-330] ----VYIYSPEYVSMC--DSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQE-GD-DD--H--P--DSIEYGLGY-DCPATEGIFDYAAAIGGATITAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFE-RILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFP-G-TGDVSDVGLGKGRYYSVNVPIQGGIQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTP------VGIGK-------CLKYILQWQL---ATLIL-GGGGFNLANT-----ARCWTYLTGVILGKTLSS-E--------------------------------------------------------
65 PsiBlast_CBE 85.9032% -51 - C2 -5DC5 HDAC8_HUMAN B:[17-330] ----VYIYSPEYVSMC--DSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQE---------------SIEYGL---DCPATEGIFDYAAAIGGATITAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFE-RILYVNLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFP-G-TGDVSDVGLGKGRYYSVNVPIQDGIQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTP------VGIGK-------CLKYILQWQL---ATLIL-GGGGYNLANT-----ARCWTYLTGVILGKTLSS-E--------------------------------------------------------