@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu30610: (2016-07-20 )
MSFLHVDHVTHTYFSIKEKTTAVRDIHFDAEKGDFISFLGPSGCGKTTLLSIIAGLIEPSEGRVLIEGREPNQKEHNIGYMLQQDYLFPWKSIEENVLLGLKIADTLTEESKAAALGLLPEFGLIDVEKKYPKELSGGMRQRAALARTLAPNPSLLLLDEPFSALDFQTKLSLENLVFRTLKEYQKTAVLVTHDIGEAIAMSDTIFLFSNQPGTIHQIFTIPKELAAMLPFDARQEPSFQTLFQTIWKELNSLEKQQRNH

Atome Classification :

(53 SA) -.........10........20........30........40........50........60.......------.--------70----..--------.---------.-------...-------.-------.80...-.....90........---100--...----....-.110.......120--.......130---........140.......150.......160.......170....-...180.......190.......200.......210--.........220--.......230....--------------------...240.......250.......260------------------------------------------------------------------------------------------------
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) -MSFLHVDHVTHTYFSIKEKTTAVRDIHFDAEKGDFISFLGPSGCGKTTLLSIIAGLIEPSEGRVLIEG------R--------E-----PN--------Q---------K-------EHN-------I-------GYMLQQ-DYLFPWKSIEENVLL---G-L--KIA----DTLT-EESKAAALGLLPEF--GLIDVEKKY----PKELSGGMRQRAALARTLAPNPSLLLLDEPFSALDFQTKLSLENL-VFRTLKEYQKTAVLVTHDIGEAIAMSDTIFLFSN----QPGTIHQIFTIP--KELAAMLPFDARQE--------------------PSFQTLFQTIWKELNSLEKQQRNH--------------------------------------------------------------------------------------------------
104 Fugue 81.5033% -13 - C1 -1OXS ? C:[1-352] -MVRIIVKNVSKVF--KKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDD------R--------L-----VASNGKLIVPP---------E-------DRK-------I-------GMVFQT-WALYPNLTAFENIAF---P-L--TNM----KMSK-EEIRKRVEEVAKIL--DIHHVLNHF----PRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARAL-VKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVK------GKLVQVGK-----------PEDLYDN--------------------PVSIQVASLI-GEINELEGKVTNEGVVIGSLRFPVSVSSDRAIIGIRPEDVKLSKDVIKDDSWILVGKGKVKVIGYQGGLFRITITPLDSEEEIFTYSDHPIHSGEEVLVYVRKDKIKVFEK
115 HHSearch 72.2337% -58 - C1 -1Z47 ? A:[13-228] --MTIEFVGVEKIYPG---GARSVRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGG------K--------R-----VT--------DLPP------Q-------KRN-------V-------GLVFQN-YALFQHMTVYDNVSF---G-L--REK----RVPK-DEMDARVRELLRFM--RLESYANRF----PHELSGGQQQRVALARALAPRPQVLLFDEPFAAIDTQIRRELRTF-VRQVHDEMGVTSVFVTHDQEEALEVADRVLVLHE------GNVEQFG-----------------------------------------------------------------------------------------------------------------------------------------------------------------
122 HHSearch 71.9436% -62 - C1 -3RLF MALK_ECOLI A:[2-216] --ASVQLQNVTKAWG----EVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGE------K--------R-----MN--------DTPP------A-------ERG-------V-------GMVFQS-YALYPHLSVAENMSF---G-L--KLA----GAKK-EVINQRVNQVAEVL--QLAHLLDRK----PKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIE-ISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDA------GRVAQVG-----------------------------------------------------------------------------------------------------------------------------------------------------------------
107 Fugue 71.8131% 7 - C1 -1Z47 ? A:[11-355] GSMTIEFVGVEKIY---PGGARSVRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGG------K--------R-----VTDLP-----P---------Q-------KRN-------V-------GLVFQN-YALFQHMTVYDNVSF---G-L--REK----RVPK-DEMDARVRELLRFM--RLESYANRF----PHELSGGQQQRVALARALAPRPQVLLFDEPFAAIDTQIRRELRTF-VRQVHDEMGVTSVFVTHDQEEALEVADRVLVLHEGNVEQFGTPEEVYEKPGTLFVASFIGESNVWT--------------------RAVQNGRIEVAGAALPVDPAVSEGSEVAVVVRPKDVELQPASEREAHAQVVRSAFKGSYSACWIRTKDGEVWEVHVPSADRHRWSPGAWVHMNVTRWFIFPR--------------------
21 PsiBlast_CBE 71.2539% -29 - C1 -1Z47 ? B:[30-233] ----------------------SVRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGG------K--------RVTDL-PP--------Q---------K--------RN-------V-------GLVFQN-YALFQHMTVYDNVSF---G-L--REK----RVPK-DEMDARVRELLRFM--RLESYANRF----PHELSGGQQQRVALARALAPRPQVLLFDEPFAAIDTQIRRELRTF-VRQVHDEMGVTSVFVTHDQEEALEVADRVLVLHE------GNVEQ-FGTP--EEV---------------------------------------------------------------------------------------------------------------------------------------------------------
35 PsiBlast_CBE 70.8335% -36 - C1 -3FVQ FBPC_NEIG1 B:[5-237] ----LHIGHLSKSF----QNTPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSG------K--------T-----IF--------S---------KNTNLPVRERR-------L-------GYLVQE-GVLFPHLTVYRNIAY---G-L--GNG----KGRT-AQERQRIEAMLELT--GISELAGRY----PHELSGGQQQRAALARALAPDPELILLDEPFSALDEQLRRQIRED-MIAALRANGKSAVFVSHDREEALQYADRIAVMKQGRILQTASPHELYRQP--ADLDAAL-----------------------------------------------------------------------------------------------------------------------------------------------------
108 Fugue 70.6228% -33 - C1 -3TUZ METN_ECOLI H:[23-362] --HMIKLSNITKVFHQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDG------QELTTLSESE-----LT--------K---------A-------RRQ-------I-------GMIFQH-FNLLSSRTVFGNVAL---P-L--ELD----NTPK-DEVKRRVTELLSLV--GLGDKHDSY----PSNLSGGQKQRVAIARALASNPKVLLCDQATSALDPATTRSILEL-LKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQDTVSEVFSHP--KTPLAQKFIQSTLHLDIPEDYQERLQAEPFTDCVPMLRLEFTGQSVDAPLLSETARRFNVNNNIISAQMDYAGGVKFGIMLTEMHGTQQDTQAAIAWLQEHHVKVEV-------------------------------------------------
24 PsiBlast_CBE 69.3934% -61 - C1 -3PUZ MALK_ECOLI B:[2-215] --ASVQLQNVTKAWGEV----VVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGE------K--------R-----MN--------DTPP------A-------ERG-------V-------GMVFQS-YALYPHLSVAENMSF---G-L--KLA----GAKK-EVINQRVNQVAEVL--QLAHLLDRK----PKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIE-ISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLD------AGRVAQV------------------------------------------------------------------------------------------------------------------------------------------------------------------
12 PsiBlast_PDB 69.0234% -62 - C1 -3PUW MALK_ECOLI A:[2-215] --ASVQLQNVTKAWGEV----VVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGE------K--------R-----MN--------DTPP------A-------ERG-------V-------GMVFQS-YALYPHLSVAENMSF---G-L--KLA----GAKK-EVINQRVNQVAEVL--QLAHLLDRK----PKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIE-ISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLD------AGRVAQV------------------------------------------------------------------------------------------------------------------------------------------------------------------
16 PsiBlast_PDB 68.9034% -65 - C1 -4KHZ - ? A:[2-215] --ASVQLQNVTKAWGEV----VVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGE------K--------R-----MN--------DTPP------A-------ERG-------V-------GMVFQS-YALYPHLSVAENMSF---G-L--KLA----GAKK-EVINQRVNQVAEVL--QLAHLLDRK----PKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIE-ISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLD------AGRVAQV------------------------------------------------------------------------------------------------------------------------------------------------------------------
36 PsiBlast_CBE 68.7435% -33 - C1 -3FVQ FBPC_NEIG1 A:[5-242] ----LHIGHLSKSF----QNTPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSG------K--------T-----IF--------S---------KNTNLPVRERR-------L-------GYLVQE-GVLFPHLTVYRNIAY---G-L--GNG----KGRT-AQERQRIEAMLELT--GISELAGRY----PHELSGGQQQRAALARALAPDPELILLDEPFSALDEQLRRQIRED-MIAALRANGKSAVFVSHDREEALQYADRIAVMKQGRILQTASPHELYRQP--ADLDAAL-----------------------------------------------------------------------------------------------------------------------------------------------------
13 PsiBlast_PDB 68.2634% -63 - C1 -3PUX MALK_ECOLI A:[2-215] --ASVQLQNVTKAWGEV----VVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGE------K--------R-----MN--------DTPP------A-------ERG-------V-------GMVFQS-YALYPHLSVAENMSF---G-L--KLA----GAKK-EVINQRVNQVAEVL--QLAHLLDRK----PKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIE-ISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLD------AGRVAQV------------------------------------------------------------------------------------------------------------------------------------------------------------------
17 PsiBlast_PDB 68.1234% -64 - C1 -4KI0 MALK_ECOLI A:[2-215] --ASVQLQNVTKAWGEV----VVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGE------K--------R-----MN--------DTPP------A-------ERG-------V-------GMVFQS-YALYPHLSVAENMSF---G-L--KLA----GAKK-EVINQRVNQVAEVL--QLAHLLDRK----PKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIE-ISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLD------AGRVAQV------------------------------------------------------------------------------------------------------------------------------------------------------------------
11 PsiBlast_PDB 68.1034% -64 - C1 -3PUV MALK_ECOLI A:[2-215] --ASVQLQNVTKAWGEV----VVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGE------K--------R-----MN--------DTPP------A-------ERG-------V-------GMVFQS-YALYPHLSVAENMSF---G-L--KLA----GAKK-EVINQRVNQVAEVL--QLAHLLDRK----PKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIE-ISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLD------AGRVAQV------------------------------------------------------------------------------------------------------------------------------------------------------------------
25 PsiBlast_CBE 68.0834% -64 - C1 -3PUY MALK_ECOLI B:[2-225] --ASVQLQNVTKAWGEV----VVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGE------K--------R-----MN--------DTPP------A-------ERG-------V-------GMVFQS-YALYPHLSVAENMSF---G-L--KLA----GAKK-EVINQRVNQVAEVL--QLAHLLDRK----PKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIE-ISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLD------AGRVAQV------------------------------------------------------------------------------------------------------------------------------------------------------------------
23 PsiBlast_CBE 68.0634% -59 - C1 -3RLF MALK_ECOLI B:[2-215] --ASVQLQNVTKAWGEV----VVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGE------K--------R-----MN--------DTPP------A-------ERG-------V-------GMVFQS-YALYPHLSVAENMSF---G-L--KLA----GAKK-EVINQRVNQVAEVL--QLAHLLDRK----PKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIE-ISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLD------AGRVAQV------------------------------------------------------------------------------------------------------------------------------------------------------------------
27 PsiBlast_CBE 67.4734% -60 - C1 -3PUW MALK_ECOLI B:[2-225] --ASVQLQNVTKAWGEV----VVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGE------K--------R-----MN--------DTPP------A-------ERG-------V-------GMVFQS-YALYPHLSVAENMSF---G-L--KLA----GAKK-EVINQRVNQVAEVL--QLAHLLDRK----PKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIE-ISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLD------AGRVAQV------------------------------------------------------------------------------------------------------------------------------------------------------------------
14 PsiBlast_PDB 67.3734% -63 - C1 -3RLF MALK_ECOLI A:[2-215] --ASVQLQNVTKAWGEV----VVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGE------K--------R-----MN--------DTPP------A-------ERG-------V-------GMVFQS-YALYPHLSVAENMSF---G-L--KLA----GAKK-EVINQRVNQVAEVL--QLAHLLDRK----PKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIE-ISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLD------AGRVAQV------------------------------------------------------------------------------------------------------------------------------------------------------------------
15 PsiBlast_PDB 67.1934% -63 - C1 -4JBW - MALK_ECOLI A:[2-215] --ASVQLQNVTKAWGEV----VVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGE------K--------R-----MN--------DTPP------A-------ERG-------V-------GMVFQS-YALYPHLSVAENMSF---G-L--KLA----GAKK-EVINQRVNQVAEVL--QLAHLLDRK----PKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIE-ISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLD------AGRVAQV------------------------------------------------------------------------------------------------------------------------------------------------------------------
22 PsiBlast_CBE 66.7534% -59 - C1 -4KI0 MALK_ECOLI B:[2-215] --ASVQLQNVTKAWGEV----VVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGE------K--------R-----MN--------DTPP------A-------ERG-------V-------GMVFQS-YALYPHLSVAENMSF---G-L--KLA----GAKK-EVINQRVNQVAEVL--QLAHLLDRK----PKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIE-ISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLD------AGRVAQV------------------------------------------------------------------------------------------------------------------------------------------------------------------
119 HHSearch 66.7037% -35 - C1 -3FVQ FBPC_NEIG1 A:[2-226] -TAALHIGHLSKSFQ----NTPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSG------K--------T-----IFSKNTNLP-V---------R-------ERR-------L-------GYLVQE-GVLFPHLTVYRNIAY---G-L--GNG----KGRT-AQERQRIEAMLELT--GISELAGRY----PHELSGGQQQRAALARALAPDPELILLDEPFSALDEQLRRQIRED-MIAALRANGKSAVFVSHDREEALQYADRIAVMKQ------GRILQTA-----------------------------------------------------------------------------------------------------------------------------------------------------------------
53 PsiBlast_CBE 62.9535% -30 - C1 -3TIF Y796_METJA B:[1-218] ---MVKLKNVTKTYKMGEEIIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDN------I--------K-----TN--------DLDDDELTKIR-------RDK-------I-------GFVFQQ-FNLIPLLTALENVEL---P-LIFKYR----GAMSGEERRKRALECLK-----MAELEERFANHKPNQLSGGQQQRVAIARALANNPPIILADQPTWALDSKTGEKIMQL-LKKLNEEDGKTVVVVTHDINVARFGERIIYL---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
118 HHSearch 62.0130% -54 - C1 -4YER ? A:[4-247] --DIIVVENLVKKFG----DFEAVKGVSFSVKKGEIFAFLGPNGAGKTTTIHMLTTLLKPTSGKAWVAG------H--------D-----VLKEPR----E---------V-------RRK-------I-------GIVFQD-QSLDRELTAYENMYI---H-G--KIY----GYGG-EKLKKRILELLEFV--ELLEFKDKP----VKTFSGGMARRLEIARSLIHEPEVLFLDEPTIGLDPHTRAHMWEY-ISKMKKEHNMTIFLTTHYMDEAEQLADRVAIIDH------GKIIALG-----------------------------------------------------------------------------------------------------------------------------------------------------------------
51 PsiBlast_CBE 61.3635% -30 - C1 -1L2T Y796_METJA B:[1-218] ---MIKLKNVTKTYKMGEEIIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDN------I--------K-----TN--------DLDDDELTKIR-------RDK-------I-------GFVFQQ-FNLIPLLTALENVEL---P-LIFKYR----GAMSGEERRKRALECLK-----MAELEERFANHKPNQLSGGQQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQL-LKKLNEEDGKTVVVVTHDINVARFGERIIYL---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
52 PsiBlast_CBE 61.3535% -29 - C1 -1L2T Y796_METJA A:[1-218] ---MIKLKNVTKTYKMGEEIIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDN------I--------K-----TN--------DLDDDELTKIR-------RDK-------I-------GFVFQQ-FNLIPLLTALENVEL---P-LIFKYR----GAMSGEERRKRALECLK-----MAELEERFANHKPNQLSGGQQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQL-LKKLNEEDGKTVVVVTHDINVARFGERIIYL---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
54 PsiBlast_CBE 60.9835% -36 - C1 -3TIF Y796_METJA A:[1-218] ---MVKLKNVTKTYKMGEEIIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDN------I--------K-----TN--------DLDDDELTKIR-------RDK-------I-------GFVFQQ-FNLIPLLTALENVEL---P-LIFKYR----GAMSGEERRKRALECLK-----MAELEERFANHKPNQLSGGQQQRVAIARALANNPPIILADQPTWALDSKTGEKIMQL-LKKLNEEDGKTVVVVTHDINVARFGERIIYL---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
50 PsiBlast_CBE 60.6334% -48 - C1 -4YMU ? A:[1-224] ---MIFVNDVYKNFGSLE----VLKGVTLKVNKGEVVVIIGPSGSGKSTLLRCINLLEEPTKGEVFIDG------V--------K-----IN--------N---------G-------KVN-------INKVRQKVGMVFQH-FNLFPHLTAIENITL---APV--KVK----KMNK-KEAEELAVDLLAKV--GLLDKKDQY----PIKLSGGQKQRLAIARALAMQPEVMLFDEPTSALDPEMVKEVLN--VMKQLANEGMTMVVVTHEMGFAREVGDRVIFMDDGVIVEEGTPEEIF-----------------------------------------------------------------------------------------------------------------------------------------------------------------
45 PsiBlast_CBE 55.9235% -27 - C1 -4U00 ? A:[19-231] ----------------------VLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLSVKDDR--------A-----LR--------E---------I-------RRE-------V-------GMVFQQ-FNLFPHMTVLENVTL---APM--RVR----RWPR-EKAEKKALELLERV--GILDQARKY----PAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLD--VMRDLAQGGMTMVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEEIFTRP--KE----------------------------------------------------------------------------------------------------------------------------------------------------------
40 PsiBlast_CBE 54.5934% -18 - C1 -1VCI ? A:[26-243] ---------------------TAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGD------R--------D-----VT--------YLPP------K-------DRN-------I-------SMVFQ-------HMTVYENIAF---P-L----KKFPKDEID-KRVRWAAELLQIE------ELLNRY----PAQLSGGQRQRVAVARAIVVEPDVLLMDEPLSNLDAKLRVAMRAE-IKKLQQKLKVTTIYVTHDQVEAMTMGDRIAVMNRGQLLQIGSPTEVYLRP--NSV---------------------------------------------------------------------------------------------------------------------------------------------------------
81 PsiBlast_CBE 49.6732% -49 - C1 -2OLK ? B:[39-234] ----------------------VLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDG------I--------N-----LK--------A---------K-------DTNLNKVREEV-------GMVFQR-FNLFPHMTVLNNITL---APM--KVR----KWPR-EKAEAKAMELLDKV--GLKDKAHAY----PDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLS--VMKQLANEGMTMVVVTHEMGFAREVGDRVLFMDG------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
71 PsiBlast_CBE 49.0932% -40 - C1 -3C4J ? B:[39-234] ----------------------VLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDG------I--------N-----LK--------A---------K-------DTNLNKVREEV-------GMVFQR-FNLFPHMTVLNNITL---APM--KVR----KWPR-EKAEAKAMELLDKV--GLKDKAHAY----PDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLS--VMKQLANEGMTMVVVTHEMGFAREVGDRVLFMDG------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
85 PsiBlast_CBE 49.0233% -50 - C1 -3C41 ? K:[18-213] ----------------------VLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDG------I--------N-----LK--------A---------K-------DTNLNKVREEV-------GMVFQR-FNLFPHMTVLNNITL---APM--KVR----KWPR-EKAEAKAMELLDKV--GLKDKAHAY----PDSLSGGQ