@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu30940: (2016-07-21 )
MNHSKTLLLTAAAGLMLTCGAVSSQAKHKLSDPYHFTVNAAAETEPVDTAGDAADDPAIWLDPKTPQNSKLITTNKKSGLVVYSLDGKMLHSYNTGKLNNVDIRYDFPLNGKKVDIAAASNRSEGKNTIEIYAIDGKNGTLQSMTDPDHPIATAINEVYGFTLYHSQKTGKYYAMVTGKEGEFEQYELKADKNGYISGKKVRAFKMNSQTEGMAADDEYGRLYIAEEDEAIWKFSAEPDGGSNGTVIDRADGRHLTRDIEGLTIYYAADGKGYLMASSQGNSSYAIYDRQGKNKYVADFRITDGPETDGTSDTDGIDVLGFGLGPEYPFGIFVAQDGENIDHGQKANQNFKIVPWERIADQIGFRPLANEQVDPRKLTDRSGK

Atome Classification :

(20 SA) .........10........---------20........30........40........--50........60........70........80......--.--.90........100..--.....110.......120--------......--.130....--...140...-....150.......160.......170.......180.......190....---...200.......210.......220......----------------------------------------.-230......-.240.......250-........260.......270.......280.......290.......300.......310.-----------......320.......330.......340.......350.......360.......370.......380.
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MNHSKTLLLTAAAGLMLTC---------GAVSSQAKHKLSDPYHFTVNAAAETEPVDT--AGDAADDPAIWLDPKTPQNSKLITTNKKSGLVVYSLDG--K--MLHSYNTGKLNNVDIR--YDFPLNGKKVDIAAASNR--------SEGKNT--IEIYAIDG--KNGTLQSMT-DPDHPIATAINEVYGFTLYHSQKTGKYYAMVTGKEGEFEQYELKADKNGYI---SGKKVRAFKMNSQTEGMAADDEYGRLYIAEED----------------------------------------E-AIWKFSAEP-DGGSNGTVIDRAD--GRHLTRDIEGLTIYYAADGKGYLMASSQGNSSYAIYDRQGKNKYVADFRITDGPETDGTSDT-----------DGIDVLGFGLGPEYPFGIFVAQDGENIDHGQKANQNFKIVPWERIADQIGFRPLANEQVDPRKLTDRSGK
2 PsiBlast_PDB 95.46100% -41 - C2 -3AMS PHYC_BACIU A:[2-353] --------------------------------------LSDPYHFTVNAAAETEPVDT--AGDAADDPAIWLDPKTPQNSKLITTNKKSGLVVYSLDG--K--MLHSYNTGKLNNVDIR--YDFPLNGKKVDIAAASNR--------SEGKNT--IEIYAIDG--KNGTLQSMT-DPDHPIATAINEVYGFTLYHSQKTGKYYAMVTGKEGEFEQYELKADKNGYI---SGKKVRAFKMNSQTEGMAADDEYGRLYIAEED----------------------------------------E-AIWKFSAEP-DGGSNGTVIDRAD--GRHLTRDIEGLTIYYAADGKGYLMASSQGNSSYAIYDRQGKNKYVADFRITDGPETDGTSDT-----------DGIDVLGFGLGPEYPFGIFVAQDGENIDHGQKANQNFKIVPWERIADQIGFRPLANEQVDPRKLTDRS--
1 PsiBlast_PDB 94.77100% -41 - C2 -3AMR PHYC_BACIU A:[2-353] --------------------------------------LSDPYHFTVNAAAETEPVDT--AGDAADDPAIWLDPKTPQNSKLITTNKKSGLVVYSLDG--K--MLHSYNTGKLNNVDIR--YDFPLNGKKVDIAAASNR--------SEGKNT--IEIYAIDG--KNGTLQSMT-DPDHPIATAINEVYGFTLYHSQKTGKYYAMVTGKEGEFEQYELKADKNGYI---SGKKVRAFKMNSQTEGMAADDEYGRLYIAEED----------------------------------------E-AIWKFSAEP-DGGSNGTVIDRAD--GRHLTRDIEGLTIYYAADGKGYLMASSQGNSSYAIYDRQGKNKYVADFRITDGPETDGTSDT-----------DGIDVLGFGLGPEYPFGIFVAQDGENIDHGQKANQNFKIVPWERIADQIGFRPLANEQVDPRKLTDRS--
34 Fugue 94.6392% -47 - C2 -1CVM PHYT_BACSD A:[1-353] -------------------------------------KLSDPYHFTVNAAAETEPVDT--AGDAADDPAIWLDPKNPQNSKLITTNKKSGLAVYSLEG--K--MLHSYHTGKLNNVDIR--YDFPLNGKKVDIAAASNR--------SEGKNT--IEIYAIDG--KNGTLQSIT-DPNRPIASAIDEVYGFSLYHSQKTGKYYAMVTGKEGEFEQYELNADKNGYI---SGKKVRAFKMNSQTEGMAADDEYGSLYIAEED----------------------------------------E-AIWKFSAEP-DGGSNGTVIDRAD--GRHLTPDIEGLTIYYAADGKGYLLASSQGNSSYAIYERQGQNKYVADFQITDGPETDGTSDT-----------DGIDVLGFGLGPEYPFGLFVAQNGENIDHGQKANQNFKMVPWERIADKIGFHPQVNKQVDPRKMTDRS--
6 PsiBlast_PDB 94.4992% -47 - C2 -1CVM PHYT_BACSD A:[1-353] -------------------------------------KLSDPYHFTVNAAAETEPVDT--AGDAADDPAIWLDPKNPQNSKLITTNKKSGLAVYSLEG--K--MLHSYHTGKLNNVDIR--YDFPLNGKKVDIAAASNR--------SEGKNT--IEIYAIDG--KNGTLQSIT-DPNRPIASAIDEVYGFSLYHSQKTGKYYAMVTGKEGEFEQYELNADKNGYI---SGKKVRAFKMNSQTEGMAADDEYGSLYIAEED----------------------------------------E-AIWKFSAEP-DGGSNGTVIDRAD--GRHLTPDIEGLTIYYAADGKGYLLASSQGNSSYAIYERQGQNKYVADFQITDGPETDGTSDT-----------DGIDVLGFGLGPEYPFGLFVAQNGENIDHGQKANQNFKMVPWERIADKIGFHPQVNKQVDPRKMTDRS--
13 HHSearch 94.46100% -39 - C2 -3AMR PHYC_BACIU A:[3-353] ---------------------------------------SDPYHFTVNAAAETEPVDT--AGDAADDPAIWLDPKTPQNSKLITTNKKSGLVVYSLDG--K--MLHSYNTGKLNNVDIR--YDFPLNGKKVDIAAASNR--------SEGKNT--IEIYAIDG--KNGTLQSMT-DPDHPIATAINEVYGFTLYHSQKTGKYYAMVTGKEGEFEQYELKADKNGYI---SGKKVRAFKMNSQTEGMAADDEYGRLYIAEED----------------------------------------E-AIWKFSAEP-DGGSNGTVIDRAD--GRHLTRDIEGLTIYYAADGKGYLMASSQGNSSYAIYDRQGKNKYVADFRITDGPETDGTSDT-----------DGIDVLGFGLGPEYPFGIFVAQDGENIDHGQKANQNFKIVPWERIADQIGFRPLANEQVDPRKLTDRS--
33 Fugue 94.3892% -42 - C2 -1H6L PHYT_BACSD A:[1-353] -------------------------------------KLSDPYHFTVNAAAETEPVDT--AGDAADDPAIWLDPKNPQNSKLITTNKKSGLAVYSLEG--K--MLHSYHTGKLNNVDIR--YDFPLNGKKVDIAAASNR--------SEGKNT--IEIYAIDG--KNGTLQSIT-DPNRPIASAIDEVYGFSLYHSQKTGKYYAMVTGKEGEFEQYELNADKNGYI---SGKKVRAFKMNSQTEGMAADDEYGSLYIAEED----------------------------------------E-AIWKFSAEP-DGGSNGTVIDRAD--GRHLTPDIEGLTIYYAADGKGYLLASSQGNSSYAIYERQGQNKYVADFQITDGPETDGTSDT-----------DGIDVLGFGLGPEYPFGLFVAQNGENIDHGQKANQNFKMVPWERIADKIGFHPQVNKQVDPRKMTDRS--
7 PsiBlast_PDB 94.2592% -42 - C2 -1H6L PHYT_BACSD A:[1-353] -------------------------------------KLSDPYHFTVNAAAETEPVDT--AGDAADDPAIWLDPKNPQNSKLITTNKKSGLAVYSLEG--K--MLHSYHTGKLNNVDIR--YDFPLNGKKVDIAAASNR--------SEGKNT--IEIYAIDG--KNGTLQSIT-DPNRPIASAIDEVYGFSLYHSQKTGKYYAMVTGKEGEFEQYELNADKNGYI---SGKKVRAFKMNSQTEGMAADDEYGSLYIAEED----------------------------------------E-AIWKFSAEP-DGGSNGTVIDRAD--GRHLTPDIEGLTIYYAADGKGYLLASSQGNSSYAIYERQGQNKYVADFQITDGPETDGTSDT-----------DGIDVLGFGLGPEYPFGLFVAQNGENIDHGQKANQNFKMVPWERIADKIGFHPQVNKQVDPRKMTDRS--
3 PsiBlast_PDB 93.8592% -41 - C2 -1POO PHYT_BACSD A:[1-353] -------------------------------------KLSDPYHFTVNAAAETEPVDT--AGDAADDPAIWLDPKNPQNSKLITTNKKSGLAVYSLEG--K--MLHSYHTGKLNNVDIR--YDFPLNGKKVDIAAASNR--------SEGKNT--IEIYAIDG--KNGTLQSIT-DPNRPIASAIDEVYGFSLYHSQKTGKYYAMVTGKEGEFEQYELNADKNGYI---SGKKVRAFKMNSQTEGMAADDEYGSLYIAEED----------------------------------------E-AIWKFSAEP-DGGSNGTVIDRAD--GRHLTPDIEGLTIYYAADGKGYLLASSQGNSSYAIYERQGQNKYVADFQITDGPETDGTSDT-----------DGIDVLGFGLGPEYPFGLFVAQDGENIDHGQKANQNFKMVPWERIADKIGFHPQVNKQVDPRKMTDRS--
5 PsiBlast_PDB 93.5192% -45 - C2 -1QLG PHYT_BACSD A:[1-353] -------------------------------------KLSDPYHFTVNAAAETEPVDT--AGDAADDPAIWLDPKNPQNSKLITTNKKSGLAVYSLEG--K--MLHSYHTGKLNNVDIR--YDFPLNGKKVDIAAASNR--------SEGKNT--IEIYAIDG--KNGTLQSIT-DPNRPIASAIDEVYGFSLYHSQKTGKYYAMVTGKEGEFEQYELNADKNGYI---SGKKVRAFKMNSQTEGMAADDEYGSLYIAEED----------------------------------------E-AIWKFSAEP-DGGSNGTVIDRAD--GRHLTPDIEGLTIYYAADGKGYLLASSQGNSSYAIYERQGQNKYVADFQITDGPETDGTSDT-----------DGIDVLGFGLGPEYPFGLFVAQNGENIDHGQKANQNFKMVPWERIADKIGFHPQVNKQVDPRKMTDRS--
4 PsiBlast_PDB 93.3792% -42 - C2 -2POO PHYT_BACSD A:[1-353] -------------------------------------KLSDPYHFTVNAAAETEPVDT--AGDAADDPAIWLDPKNPQNSKLITTNKKSGLAVYSLEG--K--MLHSYHTGKLNNVDIR--YDFPLNGKKVDIAAASNR--------SEGKNT--IEIYAIDG--KNGTLQSIT-DPNRPIASAIDEVYGFSLYHSQKTGKYYAMVTGKEGEFEQYELNADKNGYI---SGKKVRAFKMNSQTEGMAADDEYGSLYIAEED----------------------------------------E-AIWKFSAEP-DGGSNGTVIDRAD--GRHLTPDIEGLTIYYAADGKGYLLASSQGNSSYAIYERQGQNKYVADFQITDGPETDGTSDT-----------DGIDVLGFGLGPEYPFGLFVAQDGENIDHGQKANQNFKMVPWERIADKIGFHPQVNKQVDPRKMTDRS--
42 Fugue 34.3910% 11 - C2 -1IJQ - LDLR_HUMAN A:[377-692] ----IAYLFFTNRHEVRKM---------TLDRSEYTSLIPNL----------RNVVAL--DTEVASNRIYWSDLS---QRMICSTQLYDTVISRDIQAPDG--LAVDWIHSNIYWTD-------------------------------SVLGT--VSVADTKG--VKRKTLFRE-NGSKPRAIVVD----------PVHGFMYWTDWGTPAKIKKGGLNGVDIYSL---VTENI------QWPNGITLDLLSGRLYWVDSK----------------------------------------L-HSISSID-V-NGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLS-PEDMVLFHNLTQPRGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLT----------------------------------
35 Fugue 32.9113% 24 - C2 -1Q7F - BRAT_DROME A:[759-1037] -IKRQRMIYHCKFG----------------EFGVMEGQFTEPSGVAVN----------------------------AQNDIIVADTNNHRIQIFDKEG--R--FKFQFGECGKRDSQLLYPNRVAVVRNSGDIIVTERS--------PT--HQ--IQIYNQYG--QFVRKFGAT-ILQHPRGVTVDNKGRIIVVEC---KVMRVIIFDQNGNVLHKFGCSKHLEFP---NGVVV---------------NDKQEIFISDNR----------------------------------------AHCVKVFN-------YEGQYLRQIG--GEGITNYPIGVGI---NSNGEILIADNHNNFNLTIFTQDGQLISALESKVKHAQCFDVALMD-----------DG--------------SVVLASK----------DYRLYIYRYVQLAP--------------------VGM
29 HHSearch 31.5218% -62 - C2 -1PBY ? B:[114-162] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PTRVALYDAETL----------SRRKAFEAPRQITMLAWARDGSKLYGLGRD-------------------------------------------LHVMDPE----------------------------------------------------------------------------------------------------------------------------------------------------------------
38 Fugue 29.799% 14 - C2 -2QXV - EED_MOUSE A:[81-432] FKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVDADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPIT--M--QCIKHYVGHGNAINEL--KFHPRDPN--LLLSVSKDHALRLWNIQTDTLV--AIFGGVEG--HRDEVLSADYDLLGEKIMSCGMDHSLKLWRI-NSKRMMNAIKESYDYNFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKM----------------------------------------E-D--DIDKIK-PSESNVTILGRFD--YSQCDIW----YMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAA------------------IRQTSFSRDSSILIAVCDDA-------------SIWRWDRL-------------------------
41 Fugue 29.0423% -25 - C3 -2JTD - A:[1-122] -----------------------------------------------------EEEMK--RLLALSQEHKF--PTVPTKSELAVEILEKGQVRFWMQA--E--KLSS-------NAKVS--YIF--NEKEIFEGPKYKM--------HIDRNTGIIEMFM----------EKLQ-DEDEG-------TYTFQIQDGKATGHSTLVLIGDVYKKLQKEAEF-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
36 Fugue 28.5010% 35 - C2 -1RI6 - 6PGL_ECOLI A:[2-334] -SLKQTVYIASPESQQIHV---------WNLNHEGALTLTQVVD----VPGQVQPMVV--SPD--------------KRYLYVGVRPEFRVLAYRIAP--DDGALTFAAESALPGSLTH--ISTDHQGQFVFVGS-------------YNAGN--VSVTRLEDGLPVGVVDVVE-GLDGCHSANIS-----------PDNRTLWVPALKQDRICLFTVSDDGHLVA---QDPAEVTTVEGAGPRHMVFHPNEQYAYCVNEL----------------------------------------N-SSVDVWELK-DPHGNIECVQTLDMMPENFSDTRWAADIHITPDGR-HLYACDRTASLITVFSV--------------------SEDG-----------SVLSKEGFQPTETQPRGFNVDHSGKYLIAAGQKSHHISVYEIVGEQGLLHEKGRYAVGQGPMWVVVNAHE
16 HHSearch 28.396% -28 - C2 -5I5M ? A:[213-346] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SLFNVIDAEK----------MEVAFQVMVDGNLDNTDADYDGKYFFSTCYNSEMGMNLGEMITAERDHVVVFSLERCLAALKAGKFTNYNGN-KVPVLDGRKGSD-----LTRYIP-----VPKSPHGINTAP---DGKYFVANGKLSPTVSVVEIAR-------------------------------------------------------------------------------------------------------