@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu30990: (2016-07-21 )
MNQSKQLVRLIEIAIMTAAAVILDIVSGMFLSMPQGGSVSIMMIPIFLISFRWGVKAGLTTGLLTGLVQIAIGNLFAQHPVQLLLDYIVAFAAIGISGCFASSVRKAAVSKTKGKLIVSVVSAVFIGSLLRYAAHVISGAVFFGSFAPKGTPVWIYSLTYNATYMVPSFIICAIVLCLLFMTAPRLLKSDKA

Atome Classification :

(20 SA) .........10-........20.......-.30....-.....40........50........60........70........80.-----.......90.....-...100.......110.......120.......130.......140....-...150......-.160.......170.......180.......190
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MNQSKQLVRLI-EIAIMTAAAVILDIVSG-MF-LSMP-QGGSVSIMMIPIFLISFRWGVKAGLTTGLLTGLVQIAIGNLFAQHPVQ-----LLLDYIVAFAAIGI-SGCFASSVRKAAVSKTKGKLIVSVVSAVFIGSLLRYAAHVISGAVFFGSF-APKGTPVWIYSL-TYNATYMVPSFIICAIVLCLLFMTAPRLLKSDKA
15 PsiBlast_CBE 94.8232%-209 - C6 -4MHW ? B:[17-186] ------NVRLLTEIAFMAALAFIISLIPN-----TVY-GWIIVEIACIPILLLSLRRGLTAGLVGGLIWGILSMITGHAYILSLSQ-----AFLEYLVAPVSLGI-AGLFR--------QKTAPLKLAPVLLGTFVAVLLKYFFHFIAGIIFWSQY-AWKGWGAVAYSL-AVNGISGILTAIAAFVILIIFVKKFPKL------
8 PsiBlast_PDB 93.8732%-216 - C6 -4POV THIT_LACLM A:[15-186] ----KFNVRLLTEIAFMAALAFIISLIPN-----TVY-GWIIVEIACIPILLLSLRRGLTAGLVGGLIWGILSMITGHAYILSLSQ-----AFLEYLVAPVSLGI-AGLFR--------QKTAPLKLAPVLLGTFVAVLLKYFFHFIAGIIFWSQY-AWKGWGAVAYSL-AVNGISGILTAIAAFVILIIFVKKFPKL------
13 PsiBlast_CBE 93.8332%-212 - C6 -4POP THIT_LACLM B:[17-186] ------NVRLLTEIAFMAALAFIISLIPN-----TVY-GWIIVEIACIPILLLSLRRGLTAGLVGGLIWGILSMITGHAYILSLSQ-----AFLEYLVAPVSLGI-AGLFR--------QKTAPLKLAPVLLGTFVAVLLKYFFHFIAGIIFWSQY-AWKGWGAVAYSL-AVNGISGILTAIAAFVILIIFVKKFPKL------
4 PsiBlast_PDB 93.8232%-210 - C6 -3RLB ? A:[17-186] ------NVRLLTEIAFMAALAFIISLIPN-----TVY-GWIIVEIACIPILLLSLRRGLTAGLVGGLIWGILSMITGHAYILSLSQ-----AFLEYLVAPVSLGI-AGLFR--------QKTAPLKLAPVLLGTFVAVLLKYFFHFIAGIIFWSQY-AWKGWGAVAYSL-AVNGISGILTAIAAFVILIIFVKKFPKL------
14 PsiBlast_CBE 93.7632%-212 - C6 -4MUU ? B:[16-186] -----FNVRLLTEIAFMAALAFIISLIPN-----TVY-GWIIVEIACIPILLLSLRRGLTAGLVGGLIWGILSMITGHAYILSLSQ-----AFLEYLVAPVSLGI-AGLFR--------QKTAPLKLAPVLLGTFVAVLLKYFFHFIAGIIFWSQY-AWKGWGAVAYSL-AVNGISGILTAIAAFVILIIFVKKFPKL------
5 PsiBlast_PDB 93.5632%-213 - C6 -4MHW ? A:[16-186] -----FNVRLLTEIAFMAALAFIISLIPN-----TVY-GWIIVEIACIPILLLSLRRGLTAGLVGGLIWGILSMITGHAYILSLSQ-----AFLEYLVAPVSLGI-AGLFR--------QKTAPLKLAPVLLGTFVAVLLKYFFHFIAGIIFWSQY-AWKGWGAVAYSL-AVNGISGILTAIAAFVILIIFVKKFPKL------
3 PsiBlast_PDB 93.1332%-215 - C6 -4N4D ? A:[7-176] ------NVRLLTEIAFMAALAFIISLIPN-----TVY-GWIIVEIACIPILLLSLRRGLTAGLVGGLIWGILSMITGHAYILSLSQ-----AFLEYLVAPVSLGI-AGLFR--------QKTAPLKLAPVLLGTFVAVLLKYFFHFIAGIIFWSQY-AWKGWGAVAYSL-AVNGISGILTAIAAFVILIIFVKKFPKL------
11 PsiBlast_CBE 92.3532%-216 - C6 -4MES ? B:[6-176] -----FNVRLLTEIAFMAALAFIISLIPN-----TVY-GWIIVEIACIPILLLSLRRGLTAGLVGGLIWGILSMITGHAYILSLSQ-----AFLEYLVAPVSLGI-AGLFR--------QKTAPLKLAPVLLGTFVAVLLKYFFHFIAGIIFWSQY-AWKGWGAVAYSL-AVNGISGILTAIAAFVILIIFVKKFPKL------
6 PsiBlast_PDB 92.3232%-211 - C6 -4MUU ? A:[15-186] ----KFNVRLLTEIAFMAALAFIISLIPN-----TVY-GWIIVEIACIPILLLSLRRGLTAGLVGGLIWGILSMITGHAYILSLSQ-----AFLEYLVAPVSLGI-AGLFR--------QKTAPLKLAPVLLGTFVAVLLKYFFHFIAGIIFWSQY-AWKGWGAVAYSL-AVNGISGILTAIAAFVILIIFVKKFPKL------
10 PsiBlast_CBE 92.0132%-216 - C6 -4N4D ? B:[7-176] ------NVRLLTEIAFMAALAFIISLIPN-----TVY-GWIIVEIACIPILLLSLRRGLTAGLVGGLIWGILSMITGHAYILSLSQ-----AFLEYLVAPVSLGI-AGLFR--------QKTAPLKLAPVLLGTFVAVLLKYFFHFIAGIIFWSQY-AWKGWGAVAYSL-AVNGISGILTAIAAFVILIIFVKKFPKL------
2 PsiBlast_PDB 91.5632%-215 - C6 -4MES ? A:[7-176] ------NVRLLTEIAFMAALAFIISLIPN-----TVY-GWIIVEIACIPILLLSLRRGLTAGLVGGLIWGILSMITGHAYILSLSQ-----AFLEYLVAPVSLGI-AGLFR--------QKTAPLKLAPVLLGTFVAVLLKYFFHFIAGIIFWSQY-AWKGWGAVAYSL-AVNGISGILTAIAAFVILIIFVKKFPKL------