@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu32130: (2016-07-23 )
MENVFDYEDIQLIPAKCIVNSRSECDTSVRLGGHTFKLPVVPANMQTIIDEKLAISLAENGYFYVMHRFEPETRIDFIKDMNARGLFSSISVGVKDEEYEFVRQLAEENLTPEYVTIDIAHGHSNAVIEMIQHLKKHLPDSFVIAGNVGTPEAVRELENAGADATKVGIGPGKVCITKIKTGFGTGGWQLAALRWCAKAASKPIIADGGIRTHGDIAKSIRFGATMVMIGSLFAGHEESPGQTIEKDGKLYKEYFGSASEFQKGEKKNVEGKKMHVAHKGSIKDTLIEMEQDLQSSISYAGGTKLNAIRNVDYVIVKNSIFNGDKY

Atome Classification :

(41 SA) .........10........20........30..-.-.-.....40........50........60.......----------------.----70.--.-----------.-----------------------..---.-...----80-----------.--.-.-.-----------.------------------------------------------------------------------------------------------------.------------------------------------------------------------------------------------------------...90........100.......110.......120.......130.......140....--...150.......160.......170.......180.......190.......---200-.---.---.......210.......220.......230.......240...-....250..--.....---------260.--.-----.--.....---.-270.......280.......290.......300......-.310........320....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MENVFDYEDIQLIPAKCIVNSRSECDTSVR-LG-G-H-TFKLPVVPANMQTIIDEKLAISLAENGYFYVMHR----------------F----E-P--E-----------T-----------------------RI---D-FIK----D------------M--N-A-R-----------G------------------------------------------------------------------------------------------------L------------------------------------------------------------------------------------------------FSSISVGVKDEEYEFVRQLAEENLTPEYVTIDIAHGHSNAVIEMIQHLKKHLPDSFVIAG--NVGTPEAVRELENAGADATKVGIGPGKVCITKIKTGFGTGGWQLAALRWCAKA---A---S---K---PIIADGGIRTHGDIAKSIRFGATMVMIGSLFAGHEESPGQTIE-KDGKLYKEY--FGSAS---------E--F--Q-----K--GEKKN---V-EGKKMHVAHKGSIKDTLIEMEQDLQSSISYAGGTKLNAI-RN-VDYVIVKNSIFNGDKY
1 PsiBlast_PDB 99.0188%-105 - C2 -2A1Y GUAC_BACAN A:[10-330] MGNVFDYEDIQLIPAKCIVNSRSECDTTVT-LG-K-H-KFKLPVVPANMQTIIDERIATYLAENNYFYIMHR----------------F----Q-P--E-----------K-----------------------RI---S-FIR----D------------M--Q-S-R-----------G------------------------------------------------------------------------------------------------L------------------------------------------------------------------------------------------------IASISVGVKEDEYEFVQQLAAEHLTPEYITIDIAHGHSNAVINMIQHIKKHLPESFVIAG--NVGTPEAVRELENAGADATKVGIGPGKVCITKIKTGFGTGGWQLAALRWCAKA---A---S---K---PIIADGGIRTNGDVAKSIRFGATMVMIGSLFAGHEESPGETIE-K---LYKEY--FGS-----------------------------------------FVEHKGSLEDTLIEMEQDLQSSISYAGGTKLDSI-RT-VDYVVVKNSIF-----
11 PsiBlast_PDB 64.4934% -26 - C2 -4MYX ? A:[35-352] ----LTFDDVLLVPAKSDVLPREVSVKTVL-SE-S-L-QLNIPLISAGMDTVTEADMAIAMARQGGLGIIHK----------------NMSIEQ-Q--A-----------E-----------------------QV---D-KVK--------------------R-S-G-----------G------------------------------------------------------------------------------------------------L------------------------------------------------------------------------------------------------LVGAAVGVTADAMTRIDALVKASV--DAIVLDTAHGHSQGVIDKVKEVRAKYPSLNIIAG--NVATAEATKALIEAGANVVKVGIGPGSICTTRVVAGVGV--PQLTAVYDCATE---A---R---KHGIPVIADGGIKYSGDMVKALAAGAHVVMLGSMFAGVAESPGETEI-YQGRQFKVY--RGMGSVGAMEK---------------------KL---VPEGIEGRVPYKGPLADTVHQLVGGLRAGMGYCGAQDLEFL-R------------------
96 PsiBlast_CBE 63.9233% -4 - C2 -4QJ1 ? A:[13-340] ----LTFEDILLVPNYSEVLPR-EVSLETK-LT-K-NVSLKIPLISSAMDTVTEHLMAVGMARLGGIGIIHKN---------------M----D-M--E-----------S-----------------------QV---NEVLK----V------------K--N-S-G-----------G------------------------------------------------------------------------------------------------L------------------------------------------------------------------------------------------------RVGAAIGVN--EIERAKLLVEAGV--DVIVLDSAHGHSLNIIRTLKEIKSKM-NIDVIVG--NVVTEEATKELIENGADGIKVGIGPGSICTTRIVAGVGV--PQITAIEKCSSV---A---S---KFGIPIIADGGIRYSGDIGKALAVGASSVMIGSILAGTEESPGEKEL-IGDTVYKYY--RGMGSVGAMK-----------------------NKMVP-EGIEGRVKYKGEMEGVVYQLVGGLRSCMGYLGSASIEELWKK-SSYVEITTS-------
95 PsiBlast_CBE 63.8933% -10 - C2 -4QJ1 ? B:[13-340] ----LTFEDILLVPNYSEVLPR-EVSLETK-LT-K-NVSLKIPLISSAMDTVTEHLMAVGMARLGGIGIIHKN---------------M----D-M--E-----------S-----------------------QV---NEVLK----V------------K--N-S-G-----------G------------------------------------------------------------------------------------------------L------------------------------------------------------------------------------------------------RVGAAIGVN--EIERAKLLVEAGV--DVIVLDSAHGHSLNIIRTLKEIKSKM-NIDVIVG--NVVTEEATKELIENGADGIKVGIGPGSICTTRIVAGVGV--PQITAIEKCSSV---A---S---KFGIPIIADGGIRYSGDIGKALAVGASSVMIGSILAGTEESPGEKEL-IGDTVYKYY--RGMGSVGAMKS----------------------NKMVP-EGIEGRVKYKGEMEGVVYQLVGGLRSCMGYLGSASIEELWKK-SSYVEITTS-------
116 HHSearch 63.3833% -9 - C2 -3R2G - ? A:[6-328] --QAITFDDVLLVPSYNHHESRRVVETTSTDRL-GKL-TLNLPVISANMDTITESNMANFMHSKGAMGALHR----------------F----MTI--E-----------E-----------------------NI---Q-EFK----K---------------C-K-G-----------P------------------------------------------------------------------------------------------------V------------------------------------------------------------------------------------------------FVSVGCT--ENELQRAEALRDAG--ADFFCVDVAHAHAKYVGKTLKSLRQLLG-SRCIMAG-NVATYAGADYLASCGADIIKAGIGGGSVCSTRIKTGFGVP--MLTCIQDCSR----A---D---R---SIVADGGIKTSGDIVKALAFGADFVMIGGMLAGSAPTPGEVFQKDDGSKVKRY--RGMASRE-------A--Q--EAFLGQM--HEWKT---A-EGVATEVPFKENPDGIIADIIGGLRSGLTYAGADSISEL-QRKLNYVIVTQAGR-----
48 PsiBlast_CBE 63.1634% -24 - C2 -4QM1 ? B:[35-357] ----LTFDDVLLVPAKSDVLPREVSVKTVL-SE-S-L-QLNIPLISAGMDTVTEADMAIAMARQGGLGIIHK----------------NMSIEQ-Q--A-----------E-----------------------QV---D-KVK--------------------R-S-G-----------G------------------------------------------------------------------------------------------------L------------------------------------------------------------------------------------------------LVGAAVGVTADAMTRIDALVKASV--DAIVLDTAHGHSQGVIDKVKEVRAKYPSLNIIAG--NVATAEATKALIEAGANVVKVGIGPGSICTTRVVAGVGV--PQLTAVYDCATE---A---R---KHGIPVIADGGIKYSGDMVKALAAGAHVVMLGSMFAGVAESPGETEI-YQGRQFKVY--RGMGSVGAMEK---------------------KL---VPEGIEGRVPYKGPLADTVHQLVGGLRAGMGYCGAQDLEFL-R------------------
93 PsiBlast_CBE 63.1233% -10 - C2 -4QJ1 ? D:[13-340] ----LTFEDILLVPNYSEVLPR-EVSLETK-LT-K-NVSLKIPLISSAMDTVTEHLMAVGMARLGGIGIIHKN---------------M----D-M--E-----------S-----------------------QV---NEVLK----V------------K--N-S-G-----------G------------------------------------------------------------------------------------------------L------------------------------------------------------------------------------------------------RVGAAIGVN--EIERAKLLVEAGV--DVIVLDSAHGHSLNIIRTLKEIKSKM-NIDVIVG--NVVTEEATKELIENGADGIKVGIGPGSICTTRIVAGVGV--PQITAIEKCSSV---A---S---KFGIPIIADGGIRYSGDIGKALAVGASSVMIGSILAGTEESPGEKEL-IGDTVYKYY--RGMGSVGAMKS----------------------NKMVP-EGIEGRVKYKGEMEGVVYQLVGGLRSCMGYLGSASIEELWKK-SSYVEITTS-------
113 HHSearch 63.0833% -10 - C2 -4MYA ? A:[32-369] -KEGLTFDDVLLVPAKSDVL-PREVSVKTV-LS-ESL-QLNIPLISAGMDTVTEADMAIAMARQGGLGIIHK----------------N----MSI--E-----------Q-----------------------QA---E-QVD----KV-----------K--R-S-G-----------G------------------------------------------------------------------------------------------------L------------------------------------------------------------------------------------------------LVGAAVGVTADAMTRIDALVKAS--VDAIVLDTAHGHSQGVIDKVKEVRAKYPSLNIIAG--NVATAEATKALIEAGANVVKVGIGPGSICTTRVVAGVGVP--QLTAVYDCATE---ARKHG---I---PVIADGGIKYSGDMVKALAAGAHVVMLGSMFAGVAESPGETEI-YQGRQFKVY--RGMGS---------V--G--A-----MEK-KKLV---P-EGIEGRVPYKGPLADTVHQLVGGLRAGMGYCGAQDLEFL-RENAQFIRMSGAGLLESH-
94 PsiBlast_CBE 63.0133% -10 - C2 -4QJ1 ? C:[13-340] ----LTFEDILLVPNYSEVLPR-EVSLETK-LT-K-NVSLKIPLISSAMDTVTEHLMAVGMARLGGIGIIHKN---------------M----D-M--E-----------S-----------------------QV---NEVLK----V------------K--N-S-G-----------G------------------------------------------------------------------------------------------------L------------------------------------------------------------------------------------------------RVGAAIGVN--EIERAKLLVEAGV--DVIVLDSAHGHSLNIIRTLKEIKSKM-NIDVIVG--NVVTEEATKELIENGADGIKVGIGPGSICTTRIVAGVGV--PQITAIEKCSSV---A---S---KFGIPIIADGGIRYSGDIGKALAVGASSVMIGSILAGTEESPGEKEL-IGDTVYKYY--RGMGSVGAMKS----------------------NKMVP-EGIEGRVKYKGEMEGVVYQLVGGLRSCMGYLGSASIEELWKK-SSYVEITTS-------
98 PsiBlast_CBE 62.5333% -10 - C2 -4IXH IMDH_CRYPV C:[13-340] ----LTFEDILLVPNYSEVLPR-EVSLETK-LT-K-NVSLKIPLISSAMDTVTEHLMAVGMARLGGIGIIHKN---------------M----D-M--E-----------S-----------------------QV---NEVLK----V------------K--N-S-G-----------G------------------------------------------------------------------------------------------------L------------------------------------------------------------------------------------------------RVGAAIGVN--EIERAKLLVEAGV--DVIVLDSAHGHSLNIIRTLKEIKSKM-NIDVIVG--NVVTEEATKELIENGADGIKVGIGPGSICTTRIVAGVGV--PQITAIEKCSSV---A---S---KFGIPIIADGGIRYSGDIGKALAVGASSVMIGSILAGTEESPGEKEL-IGDTVYKYY--RGMGSVGAMKSG----------------------MV-P-EGIEGRVKYKGEMEGVVYQLVGGLRSCMGYLGSASIEELWKK-SSYVEITTS-------
69 PsiBlast_CBE 62.4634% -28 - C2 -4MY1 ? F:[35-352] ----LTFDDVLLVPAKSDVLPREVSVKTVL-SE-S-L-QLNIPLISAGMDTVTEADMAIAMARQGGLGIIHK----------------NMSIEQ-Q--A-----------E-----------------------QV---D-KVK--------------------R-S-G-----------G------------------------------------------------------------------------------------------------L------------------------------------------------------------------------------------------------LVGAAVGVTADAMTRIDALVKASV--DAIVLDTAHGHSQGVIDKVKEVRAKYPSLNIIAG--NVATAEATKALIEAGANVVKVGIGPGSICTTRVVAGVGV--PQLTAVYDCATE---A---R---KHGIPVIADGGIKYSGDMVKALAAGAHVVMLGSMFAGVAESPGETEI-YQGRQFKVY--RGMGSVGAMEKG---------------------L---VPEGIEGRVPYKGPLADTVHQLVGGLRAGMGYCGAQDLEFL-R------------------
63 PsiBlast_CBE 62.4534% -27 - C2 -4MY9 ? B:[35-352] ----LTFDDVLLVPAKSDVLPREVSVKTVL-SE-S-L-QLNIPLISAGMDTVTEADMAIAMARQGGLGIIHK----------------NMSIEQ-Q--A-----------E-----------------------QV---D-KVK--------------------R-S-G-----------G------------------------------------------------------------------------------------------------L------------------------------------------------------------------------------------------------LVGAAVGVTADAMTRIDALVKASV--DAIVLDTAHGHSQGVIDKVKEVRAKYPSLNIIAG--NVATAEATKALIEAGANVVKVGIGPGSICTTRVVAGVGV--PQLTAVYDCATE---A---R---KHGIPVIADGGIKYSGDMVKALAAGAHVVMLGSMFAGVAESPGETEI-YQGRQFKVY--RGMGSVGAMEKGSK-------------------L---VPEGIEGRVPYKGPLADTVHQLVGGLRAGMGYCGAQDLEFL-R------------------
10 PsiBlast_PDB 62.3134% -20 - C2 -4MY9 ? A:[35-352] ----LTFDDVLLVPAKSDVLPREVSVKTVL-SE-S-L-QLNIPLISAGMDTVTEADMAIAMARQGGLGIIHK----------------NMSIEQ-Q--A-----------E-----------------------QV---D-KVK--------------------R-S-G-----------G------------------------------------------------------------------------------------------------L------------------------------------------------------------------------------------------------LVGAAVGVTADAMTRIDALVKASV--DAIVLDTAHGHSQGVIDKVKEVRAKYPSLNIIAG--NVATAEATKALIEAGANVVKVGIGPGSICTTRVVAGVGV--PQLTAVYDCATE---A---R---KHGIPVIADGGIKYSGDMVKALAAGAHVVMLGSMFAGVAESPGETEI-YQGRQFKVY--RGMGSVGAMEK---------------------KL---VPEGIEGRVPYKGPLADTVHQLVGGLRAGMGYCGAQDLEFL-R------------------
73 PsiBlast_CBE 62.1634% -23 - C2 -4MY1 ? B:[35-352] ----LTFDDVLLVPAKSDVLPREVSVKTVL-SE-S-L-QLNIPLISAGMDTVTEADMAIAMARQGGLGIIHK----------------NMSIEQ-Q--A-----------E-----------------------QV---D-KVK--------------------R-S-G-----------G------------------------------------------------------------------------------------------------L------------------------------------------------------------------------------------------------LVGAAVGVTADAMTRIDALVKASV--DAIVLDTAHGHSQGVIDKVKEVRAKYPSLNIIAG--NVATAEATKALIEAGANVVKVGIGPGSICTTRVVAGVGV--PQLTAVYDCATE---A---R---KHGIPVIADGGIKYSGDMVKALAAGAHVVMLGSMFAGVAESPGETEI-YQGRQFKVY--RGMGSVGAMEKGS--------------------L---VPEGIEGRVPYKGPLADTVHQLVGGLRAGMGYCGAQDLEFL-R------------------
55 PsiBlast_CBE 62.0734% -24 - C2 -4MYX ? B:[35-352] ----LTFDDVLLVPAKSDVLPREVSVKTVL-SE-S-L-QLNIPLISAGMDTVTEADMAIAMARQGGLGIIHK----------------NMSIEQ-Q--A-----------E-----------------------QV---D-KVK--------------------R-S-G-----------G------------------------------------------------------------------------------------------------L------------------------------------------------------------------------------------------------LVGAAVGVTADAMTRIDALVKASV--DAIVLDTAHGHSQGVIDKVKEVRAKYPSLNIIAG--NVATAEATKALIEAGANVVKVGIGPGSICTTRVVAGVGV--PQLTAVYDCATE---A---R---KHGIPVIADGGIKYSGDMVKALAAGAHVVMLGSMFAGVAESPGETEI-YQGRQFKVY--RGMGSVGAMEKGSK------------------KL---VPEGIEGRVPYKGPLADTVHQLVGGLRAGMGYCGAQDLEFL-R------------------
68 PsiBlast_CBE 62.0634% -21 - C2 -4MY1 ? G:[35-352] ----LTFDDVLLVPAKSDVLPREVSVKTVL-SE-S-L-QLNIPLISAGMDTVTEADMAIAMARQGGLGIIHK----------------NMSIEQ-Q--A-----------E-----------------------QV---D-KVK--------------------R-S-G-----------G------------------------------------------------------------------------------------------------L------------------------------------------------------------------------------------------------LVGAAVGVTADAMTRIDALVKASV--DAIVLDTAHGHSQGVIDKVKEVRAKYPSLNIIAG--NVATAEATKALIEAGANVVKVGIGPGSICTTRVVAGVGV--PQLTAVYDCATE---A---R---KHGIPVIADGGIKYSGDMVKALAAGAHVVMLGSMFAGVAESPGETEI-YQGRQFKVY--RGMGSVGAME-----------------------L---VPEGIEGRVPYKGPLADTVHQLVGGLRAGMGYCGAQDLEFL-R------------------
46 PsiBlast_CBE 62.0534% -27 - C2 -4QM1 ? D:[35-356] ----LTFDDVLLVPAKSDVLPREVSVKTVL-SE-S-L-QLNIPLISAGMDTVTEADMAIAMARQGGLGIIHK----------------NMSIEQ-Q--A-----------E-----------------------QV---D-KVK--------------------R-S-G-----------G------------------------------------------------------------------------------------------------L------------------------------------------------------------------------------------------------LVGAAVGVTADAMTRIDALVKASV--DAIVLDTAHGHSQGVIDKVKEVRAKYPSLNIIAG--NVATAEATKALIEAGANVVKVGIGPGSICTTRVVAGVGV--PQLTAVYDCATE---A---R---KHGIPVIADGGIKYSGDMVKALAAGAHVVMLGSMFAGVAESPGETEI-YQGRQFKVY--RGMGSVGAME-----------------------L---VPEGIEGRVPYKGPLADTVHQLVGGLRAGMGYCGAQDLEFL-R------------------
50 PsiBlast_CBE 61.9734% -26 - C2 -4MYX ? G:[35-352] ----LTFDDVLLVPAKSDVLPREVSVKTVL-SE-S-L-QLNIPLISAGMDTVTEADMAIAMARQGGLGIIHK----------------NMSIEQ-Q--A-----------E-----------------------QV---D-KVK--------------------R-S-G-----------G------------------------------------------------------------------------------------------------L------------------------------------------------------------------------------------------------LVGAAVGVTADAMTRIDALVKASV--DAIVLDTAHGHSQGVIDKVKEVRAKYPSLNIIAG--NVATAEATKALIEAGANVVKVGIGPGSICTTRVVAGVGV--PQLTAVYDCATE---A---R---KHGIPVIADGGIKYSGDMVKALAAGAHVVMLGSMFAGVAESPGETEI-YQGRQFKVY--RGMGSVGAMEKGSK-----------------KKL---VPEGIEGRVPYKGPLADTVHQLVGGLRAGMGYCGAQDLEFL-R------------------
91 PsiBlast_CBE 61.8233% -3 - C2 -3KHJ ? B:[13-339] ----LTFEDILLVPNYSEVLPR-EVSLETK-LT-K-NVSLKIPLISSAMDTVTEHLMAVGMARLGGIGIIHKN---------------M----D-M--E-----------S-----------------------QVN--E-VLK----V------------K--N-S-G-----------G------------------------------------------------------------------------------------------------L------------------------------------------------------------------------------------------------RVGAAIGVN--EIERAKLLVEAGV--DVIVLDSAHGHSLNIIRTLKEIKSKM-NIDVIVG--NVVTEEATKELIENGADGIKVGIGPGSICTTRIVAGVGV--PQITAIEKCSSV---A---S---KFGIPIIADGGIRYSGDIGKALAVGASSVMIGSILAGTEESPGEKEL-IGDTVYKYY--RGMGSVGAMK------------------------MV-P-EGIEGRVKYKGEMEGVVYQLVGGLRSCMGYLGSASIEELWKK-SSYVEITT--------
90 PsiBlast_CBE 61.8233% -10 - C2 -3KHJ ? C:[13-340] ----LTFEDILLVPNYSEVLPR-EVSLETK-LT-K-NVSLKIPLISSAMDTVTEHLMAVGMARLGGIGIIHKN---------------M----D-M--E-----------S-----------------------QVN--E-VLK----V------------K--N-S-G-----------G------------------------------------------------------------------------------------------------L------------------------------------------------------------------------------------------------RVGAAIGVN--EIERAKLLVEAGV--DVIVLDSAHGHSLNIIRTLKEIKSKM-NIDVIVG--NVVTEEATKELIENGADGIKVGIGPGSICTTRIVAGVGV--PQITAIEKCSSV---A---S---KFGIPIIADGGIRYSGDIGKALAVGASSVMIGSILAGTEESPGEKEL-IGDTVYKYY--R---------------------------------------GIEGRVKYKGEMEGVVYQLVGGLRSCMGYLGSASIEELWKK-SSYVEITTS-------
56 PsiBlast_CBE 61.6534% -22 - C2 -4MYA ? B:[35-352] ----LTFDDVLLVPAKSDVLPREVSVKTVL-SE-S-L-QLNIPLISAGMDTVTEADMAIAMARQGGLGIIHK----------------NMSIEQ-Q--A-----------E-----------------------QV---D-KVK--------------------R-S-G-----------G------------------------------------------------------------------------------------------------L------------------------------------------------------------------------------------------------LVGAAVGVTADAMTRIDALVKASV--DAIVLDTAHGHSQGVIDKVKEVRAKYPSLNIIAG--NVATAEATKALIEAGANVVKVGIGPGSICTTRVVAGVGV--PQLTAVYDCATE---A---R---KHGIPVIADGGIKYSGDMVKALAAGAHVVMLGSMFAGVAESPGETEI-YQGRQFKVY--RGMGSVGAMEK---------------------KL---VPEGIEGRVPYKGPLADTVHQLVGGLRAGMGYCGAQDLEFL-R------------------