@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu32250: (2016-07-23 )
MWKGLIHQYKEFLPVTDQTPALTLHEGNTPLIHLPKLSEQLGIELHVKTEGVNPTGSFKDRGMVMAVAKAKEEGNDTIMCASTGNTSAAAAAYAARANMKCIVIIPNGKIAFGKLAQAVMYGAEIIAIDGNFDDALKIVRSICEKSPIALVNSVNPYRIEGQKTAAFEVCEQLGEAPDVLAIPVGNAGNITAYWKGFKEYHEKNGTGLPKMRGFEAEGAAAIVRNEVIENPETIATAIRIGNPASWDKAVKAAEESNGKIDEVTDDEILHAYQLIARVEGVFAEPGSCASIAGVLKQVKSGEIPKGSKVVAVLTGNGLKDPNTAVDISEIKPVTLPTDEDSILEYVKGAARV

Atome Classification :

(21 SA) .........10........20........30...--.....40-..--..--.....50........60........70........80........90........100.......110........120.......130.......140.....-.-.150.......160.......170.......180.......190.......200-.-..-..-..210.......220.......230.......240.......250.......260.......270.......280.......290.......300.......310.......320.......330.......340.......350
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MWKGLIHQYKEFLPVTDQTPALTLHEGNTPLIHL--PKLSEQ--LG--IE--LHVKTEGVNPTGSFKDRGMVMAVAKAKEEGNDTIMCASTGNTSAAAAAYAARANMKCIVIIPNGKI-AFGKLAQAVMYGAEIIAIDGNFDDALKIVRSICEKSP-I-ALVNSVNPYRIEGQKTAAFEVCEQLGEAPDVLAIPVGNAGNITAYWKGFKEYHE-K-NG-TG-LPKMRGFEAEGAAAIVRNEVIENPETIATAIRIGNPASWDKAVKAAEESNGKIDEVTDDEILHAYQLIARVEGVFAEPGSCASIAGVLKQVKSGEIPKGSKVVAVLTGNGLKDPNTAVDISEIKPVTLPTDEDSILEYVKGAARV
2 PsiBlast_PDB 84.9961% -32 - C2 -2D1F THRC_MYCTU A:[12-337] -WPGVIAAYRDRLPVGDDWTPVTLLEGGTPLIAA--TNLSKQ--TG--CT--IHLKVEGLNPTGSFKDRGMTMAVTDALAHGQRAVLCASTGNTSASAAAYAARAGITCAVLIPQGKI-AMGKLAQAVMHGAKIIQIDGNFDDCLELARKMAADFPTI-SLVNSVNPVRIEGQKTAAFEIVDVLGTAPDVHALPVGNAGNITAYWKGYTEYHQ-L-GL-IDKLPRMLGTQAAGAAPLVLGEPVSHPETIATAIRIGSPASWTSAVEAQQQSKGRFLAASDEEILAAYHLVARVEGVFVEPASAASIAGLLKAIDDGWVARGSTVVCTVTGNGLKDPDTAL---------------------------
78 HHSearch 84.8058% -27 - C2 -2D1F THRC_MYCTU A:[11-358] PWPGVIAAYRDRLPVGDDWTPVTLLEGGTPLIAA--TNLSKQ--TG--CT--IHLKVEGLNPTGSFKDRGMTMAVTDALAHGQRAVLCASTGNTSASAAAYAARAGITCAVLIPQGKI-AMGKLAQAVMHGAKIIQIDGNFDDCLELARKMAADFP-TISLVNSVNPVRIEGQKTAAFEIVDVLGTAPDVHALPVGNAGNITAYWKGYTEYHQ-LGLI-DK-LPRMLGTQAAGAAPLVLGEPVSHPETIATAIRIGSPASWTSAVEAQQQSKGRFLAASDEEILAAYHLVARVEGVFVEPASAASIAGLLKAIDDGWVARGSTVVCTVTGNGLKDPDTALKDMP-SVSPVPVDPVAVVEKLG-----
1 PsiBlast_PDB 84.7060% -1 * C2 *2ZSJ ? A:[4-348] -WQGIIKQYKKYLPVDENTPIVTLYEGNTPLIEA--DNLARA--IG--FKGKIYLKYEGLNPTGSFKDRGMTLAISKAVEAGKRAVICASTGNTSASAAAYAARAGLRAYVLLPKGAV-AIGKLSQAMIYGAKVLAIQGTFDDALNIVRKIGENFP-V-EIVNSVNPYRIEGQKTAAFEICDTLGEAPDYHFIPVGNAGNITAYWKGFKIYYE-E-GKITK-LPRMMGWQAEGAAPIVKGYPIKNPQTIATAIKIGNPYSWKSALKAAQESGGKIDAVSDSEILYAYKLIASTEGVFCEPASAASVAGLIKLVREGFFKGGEVVTCTLTGNGLKDPDTAIKVCE-EPITVPPDFDEVVK--------
80 HHSearch 84.4561% -3 - C2 -2ZSJ ? A:[4-350] -WQGIIKQYKKYLPVDENTPIVTLYEGNTPLIEA--DNLARA--IGFKGK--IYLKYEGLNPTGSFKDRGMTLAISKAVEAGKRAVICASTGNTSASAAAYAARAGLRAYVLLPKG-AVAIGKLSQAMIYGAKVLAIQGTFDDALNIVRKIGENFP-V-EIVNSVNPYRIEGQKTAAFEICDTLGEAPDYHFIPVGNAGNITAYWKGFKIYYE-EGKI-TK-LPRMMGWQAEGAAPIVKGYPIKNPQTIATAIKIGNPYSWKSALKAAQESGGKIDAVSDSEILYAYKLIASTEGVFCEPASAASVAGLIKLVREGFFKGGEVVTCTLTGNGLKDPDTAIKVCE-EPITVPPDFDEVVKVL------
22 PsiBlast_CBE 84.0860% -1 - C2 -2ZSJ ? C:[4-348] -WQGIIKQYKKYLPVDENTPIVTLYEGNTPLIEA--DNLARA--IG--FKGKIYLKYEGLNPTGSFKDRGMTLAISKAVEAGKRAVICASTGNTSASAAAYAARAGLRAYVLLPKGAV-AIGKLSQAMIYGAKVLAIQGTFDDALNIVRKIGENFP-V-EIVNSVNPYRIEGQKTAAFEICDTLGEAPDYHFIPVGNAGNITAYWKGFKIYYE-E-GKITK-LPRMMGWQAEGAAPIVKGYPIKNPQTIATAIKIGNPYSWKSALKAAQESGGKIDAVSDSEILYAYKLIASTEGVFCEPASAASVAGLIKLVREGFFKGGEVVTCTLTGNGLKDPDTAIKVCE-EPITVPPDFDEVVK--------
24 PsiBlast_CBE 84.0161% -31 - C2 -2D1F THRC_MYCTU B:[12-337] -WPGVIAAYRDRLPVGDDWTPVTLLEGGTPLIAA--TNLSKQ--TG--CT--IHLKVEGLNPTGSFKDRGMTMAVTDALAHGQRAVLCASTGNTSASAAAYAARAGITCAVLIPQGKI-AMGKLAQAVMHGAKIIQIDGNFDDCLELARKMAADFPTI-SLVNSVNPVRIEGQKTAAFEIVDVLGTAPDVHALPVGNAGNITAYWKGYTEYHQ-L-GL-IDKLPRMLGTQAAGAAPLVLGEPVSHPETIATAIRIGSPASWTSAVEAQQQSKGRFLAASDEEILAAYHLVARVEGVFVEPASAASIAGLLKAIDDGWVARGSTVVCTVTGNGLKDPDTAL---------------------------
21 PsiBlast_CBE 83.8360% -2 - C2 -2ZSJ ? D:[4-348] -WQGIIKQYKKYLPVDENTPIVTLYEGNTPLIEA--DNLARA--IG--FKGKIYLKYEGLNPTGSFKDRGMTLAISKAVEAGKRAVICASTGNTSASAAAYAARAGLRAYVLLPKG---AIGKLSQAMIYGAKVLAIQGTFDDALNIVRKIGENFP-V-EIVNSVNPYRIEGQKTAAFEICDTLGEAPDYHFIPVGNAGNITAYWKGFKIYYE-E-GKITK-LPRMMGWQAEGAAPIVKGYPIKNPQTIATAIKIGNPYSWKSALKAAQESGGKIDAVSDSEILYAYKLIASTEGVFCEPASAASVAGLIKLVREGFFKGGEVVTCTLTGNGLKDPDTAIKVCE-EPITVPPDFDEVVK--------
23 PsiBlast_CBE 83.5860% -1 - C2 -2ZSJ ? B:[4-348] -WQGIIKQYKKYLPVDENTPIVTLYEGNTPLIEA--DNLARA--IG--FKGKIYLKYEGLNPTGSFKDRGMTLAISKAVEAGKRAVICASTGNTSASAAAYAARAGLRAYVLLPKGAV-AIGKLSQAMIYGAKVLAIQGTFDDALNIVRKIGENFP-V-EIVNSVNPYRIEGQKTAAFEICDTLGEAPDYHFIPVGNAGNITAYWKGFKIYYE-E-GKITK-LPRMMGWQAEGAAPIVKGYPIKNPQTIATAIKIGNPYSWKSALKAAQESGGKIDAVSDSEILYAYKLIASTEGVFCEPASAASVAGLIKLVREGFFKGGEVVTCTLTGNGLKDPDTAIKVCE-EPITVPPDFDEVVK--------
79 HHSearch 75.8454% -0 - C2 -3AEY ? A:[2-348] -RPPLIERYRNLLPVSEKTPVISLLEGSTPLIPL--KGPEEARKKG--IR--LYAKYEGLNPTGSFKDRGMTLAVSKAVEGGAQAVACASTGNTAASAAAYAARAGILAIVVLPAGYV-ALGKVAQSLVHGARIVQVEGNFDDALRLTQKLTEAFP-V-ALVNSVNPHRLEGQKTLAFEVVDELGDAPHYHALPVGNAGNITAHWMGYKAYHA-LGKA-KR-LPRMLGFQAAGAAPLVLGRPVERPETLATAIRIGNPASWQGAVRAKEESGGVIEAVTDEEILFAYRYLAREEGIFCEPASAAAMAGVFKLLREGRLEPESTVVLTLTGHGLKDPATAERVAE-LPPPVPARLEAVAAAA------
27 PsiBlast_CBE 75.6155% 4 - C2 -1V7C ? D:[1-335] MRPPLIERYRNLLPVSEKTPVISLLEGSTPLIPLKGPEEARK--KG--IR--LYAKYEGLNPTGSFKDRGMTLAVSKAVEGGAQAVACASTGNTAASAAAYAARAGILAIVVLPAGYV-ALGKVAQSLVHGARIVQVEGNFDDALRLTQKLTEAFP-V-ALVNSVNPHRLEGQKTLAFEVVDELGDAPHYHALPVGNAGNITAHWMGYKAYHALG-KA-KR-LPRMLGFQAAGAAPLVLGRPVERPETLATAIRIGNPASWQGAVRAKEESGGVIEAVTDEEILFAYRYLAREEGIFCEPASAAAMAGVFKLLREGRLEPESTVVLTLTGHGLKDPATAERVAELPP--------------------
25 PsiBlast_CBE 75.4455% 1 - C2 -3AEY ? B:[2-335] -RPPLIERYRNLLPVSEKTPVISLLEGSTPLIPLKGPEEARK--KG--IR--LYAKYEGLNPTGSFKDRGMTLAVSKAVEGGAQAVACASTGNTAASAAAYAARAGILAIVVLPAGY--ALGKVAQSLVHGARIVQVEGNFDDALRLTQKLTEAFP-V-ALVNSVNPHRLEGQKTLAFEVVDELGDAPHYHALPVGNAGNITAHWMGYKAYHALG-KA-KR-LPRMLGFQAAGAAPLVLGRPVERPETLATAIRIGNPASWQGAVRAKEESGGVIEAVTDEEILFAYRYLAREEGIFCEPASAAAMAGVFKLLREGRLEPESTVVLTLTGHGLKDPATAERVAELPP--------------------
3 PsiBlast_PDB 75.1855% 4 - C2 -1UIM ? A:[1-335] MRPPLIERYRNLLPVSEKTPVISLLEGSTPLIPLKGPEEARK--KG--IR--LYAKYEGLNPTGSFKDRGMTLAVSKAVEGGAQAVACASTGNTAASAAAYAARAGILAIVVLPAGYV-ALGKVAQSLVHGARIVQVEGNFDDALRLTQKLTEAFP-V-ALVNSVNPHRLEGQKTLAFEVVDELGDAPHYHALPVGNAGNITAHWMGYKAYHALG-KA-KR-LPRMLGFQAAGAAPLVLGRPVERPETLATAIRIGNPASWQGAVRAKEESGGVIEAVTDEEILFAYRYLAREEGIFCEPASAAAMAGVFKLLREGRLEPESTVVLTLTGHGLKDPATAERVAELPP--------------------
28 PsiBlast_CBE 74.6355% 7 - C2 -1V7C ? C:[1-335] MRPPLIERYRNLLPVSEKTPVISLLEGSTPLIPLKGPEEARK--KG--IR--LYAKYEGLNPTGSFKDRGMTLAVSKAVEGGAQAVACASTGNTAASAAAYAARAGILAIVVLPAGYV-ALGKVAQSLVHGARIVQVEGNFDDALRLTQKLTEAFP-V-ALVNSVNPHRLEGQKTLAFEVVDELGDAPHYHALPVGNAGNITAHWMGYKAYHALG-KA-KR-LPRMLGFQAAGAAPLVLGRPVERPETLATAIRIGNPASWQGAVRAKEESGGVIEAVTDEEILFAYRYLAREEGIFCEPASAAAMAGVFKLLREGRLEPESTVVLTLTGHGLKDPATAERVAELPP--------------------
7 PsiBlast_PDB 74.3655% 1 - C2 -3AEY ? A:[2-335] -RPPLIERYRNLLPVSEKTPVISLLEGSTPLIPLKGPEEARK--KG--IR--LYAKYEGLNPTGSFKDRGMTLAVSKAVEGGAQAVACASTGNTAASAAAYAARAGILAIVVLPAGYV-ALGKVAQSLVHGARIVQVEGNFDDALRLTQKLTEAFP-V-ALVNSVNPHRLEGQKTLAFEVVDELGDAPHYHALPVGNAGNITAHWMGYKAYHALG-KA-KR-LPRMLGFQAAGAAPLVLGRPVERPETLATAIRIGNPASWQGAVRAKEESGGVIEAVTDEEILFAYRYLAREEGIFCEPASAAAMAGVFKLLREGRLEPESTVVLTLTGHGLKDPATAERVAELPP--------------------
5 PsiBlast_PDB 74.0955% 7 - C2 -1V7C ? A:[1-335] MRPPLIERYRNLLPVSEKTPVISLLEGSTPLIPLKGPEEARK--KG--IR--LYAKYEGLNPTGSFKDRGMTLAVSKAVEGGAQAVACASTGNTAASAAAYAARAGILAIVVLPAGYV-ALGKVAQSLVHGARIVQVEGNFDDALRLTQKLTEAFP-V-ALVNSVNPHRLEGQKTLAFEVVDELGDAPHYHALPVGNAGNITAHWMGYKAYHALG-KA-KR-LPRMLGFQAAGAAPLVLGRPVERPETLATAIRIGNPASWQGAVRAKEESGGVIEAVTDEEILFAYRYLAREEGIFCEPASAAAMAGVFKLLREGRLEPESTVVLTLTGHGLKDPATAERVAELPP--------------------
26 PsiBlast_CBE 73.7855% 6 - C2 -3AEX ? B:[1-335] MRPPLIERYRNLLPVSEKTPVISLLEGSTPLIPLKGPEEARK--KG--IR--LYAKYEGLNPTGSFKDRGMTLAVSKAVEGGAQAVACASTGNTAASAAAYAARAGILAIVVLPAGYV-ALGKVAQSLVHGARIVQVEGNFDDALRLTQKLTEAFP-V-ALVNSVNPHRLEGQKTLAFEVVDELGDAPHYHALPVGNAGNITAHWMGYKAYHALG-KA-KR-LPRMLGFQAAGAAPLVLGRPVERPETLATAIRIGNPASWQGAVRAKEESGGVIEAVTDEEILFAYRYLAREEGIFCEPASAAAMAGVFKLLREGRLEPESTVVLTLTGHGLKDPATAERVAELPP--------------------
4 PsiBlast_PDB 73.2255% 4 - C2 -1UIN ? A:[2-335] -RPPLIERYRNLLPVSEKTPVISLLEGSTPLIPLKGPEEARK--KG--IR--LYAKYEGLNPTGSFKDRGMTLAVSKAVEGGAQAVACASTGNTAASAAAYAARAGILAIVVLPAGYV-ALGKVAQSLVHGARIVQVEGNFDDALRLTQKLTEAFP-V-ALVNSVNPHRLEGQKTLAFEVVDELGDAPHYHALPVGNAGNITAHWMGYKAYHALG-KA-KR-LPRMLGFQAAGAAPLVLGRPVERPETLATAIRIGNPASWQGAVRAKEESGGVIEAVTDEEILFAYRYLAREEGIFCEPASAAAMAGVFKLLREGRLEPESTVVLTLTGHGLKDPATAERVAELPP--------------------
6 PsiBlast_PDB 73.1755% 7 - C2 -3AEX ? A:[1-335] MRPPLIERYRNLLPVSEKTPVISLLEGSTPLIPLKGPEEARK--KG--IR--LYAKYEGLNPTGSFKDRGMTLAVSKAVEGGAQAVACASTGNTAASAAAYAARAGILAIVVLPAGYV-ALGKVAQSLVHGARIVQVEGNFDDALRLTQKLTEAFP-V-ALVNSVNPHRLEGQKTLAFEVVDELGDAPHYHALPVGNAGNITAHWMGYKAYHALG-KA-KR-LPRMLGFQAAGAAPLVLGRPVERPETLATAIRIGNPASWQGAVRAKEESGGVIEAVTDEEILFAYRYLAREEGIFCEPASAAAMAGVFKLLREGRLEPESTVVLTLTGHGLKDPATAERVAELPP--------------------
29 PsiBlast_CBE 72.9355% 4 - C2 -1V7C ? B:[1-335] MRPPLIERYRNLLPVSEKTPVISLLEGSTPLIPLKGPEEARK--KG--IR--LYAKYEGLNPTGSFKDRGMTLAVSKAVEGGAQAVACASTGNTAASAAAYAARAGILAIVVLPAGYV-ALGKVAQSLVHGARIVQVEGNFDDALRLTQKLTEAFP-V-ALVNSVNPHRLEGQKTLAFEVVDELGDAPHYHALPVGNAGNITAHWMGYKAYHALG-KA-KR-LPRMLGFQAAGAAPLVLGRPVERPETLATAIRIGNPASWQGAVRAKEESGGVIEAVTDEEILFAYRYLAREEGIFCEPASAAAMAGVFKLLREGRLEPESTVVLTLTGHGLKDPATAERVAELPP--------------------
30 PsiBlast_CBE 72.4055% 2 - C2 -1UIN ? B:[4-335] ---PLIERYRNLLPVSEKTPVISLLEGSTPLIPLKGPEEARK--KG--IR--LYAKYEGLNPTGSFKDRGMTLAVSKAVEGGAQAVACASTGNTAASAAAYAARAGILAIVVLPAG-V-ALGKVAQSLVHGARIVQVEGNFDDALRLTQKLTEAFP-V-ALVNSVNPHRLEGQKTLAFEVVDELGDAPHYHALPVGNAGNITAHWMGYKAYHALG-KA-KR-LPRMLGFQAAGAAPLVLGRPVERPETLATAIRIGNPASWQGAVRAKEESGGVIEAVTDEEILFAYRYLAREEGIFCEPASAAAMAGVFKLLREGRLEPESTVVLTLTGHGLKDPATAERVAELPP--------------------
31 PsiBlast_CBE 72.2355% 2 - C2 -1UIM ? B:[1-335] MRPPLIERYRNLLPVSEKTPVISLLEGSTPLIPLKGPEEARK--KG--IR--LYAKYEGLNPTGSFKDRGMTLAVSKAVEGGAQAVACASTGNTAASAAAYAARAGILAIVVLPAGYV-ALGKVAQSLVHGARIVQVEGNFDDALRLTQKLTEAFP-V-ALVNSVNPHRLEGQKTLAFEVVDELGDAPHYHALPVGNAGNITAHWMGYKAYHALG-KA-KR-LPRMLGFQAAGAAPLVLGRPVERPETLATAIRIGNPASWQGAVRAKEESGGVIEAVTDEEILFAYRYLAREEGIFCEPASAAAMAGVFKLLREGRLEPESTVVLTLTGHGLKDPATAERVAELPP--------------------