@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu32290: (2016-07-23 )
MKTYKGYLIDLDGTMYNGTEKIEEACEFVRTLKDRGVPYLFVTNNSSRTPKQVADKLVSFDIPATEEQVFTTSMATAQHIAQQKKDASVYVIGEEGIRQAIEENGLTFGGENADFVVVGIDRSITYEKFAVGCLAIRNGARFISTNGDIAIPTERGLLPGNGSLTSVLTVSTGVQPVFIGKPESIIMEQAMRVLGTDVSETLMVGDNYATDIMAGINAGMDTLLVHTGVTKREHMTDDMEKPTHAIDSLTEWIPYI

Atome Classification :

(20 SA) .........10........20........30........40........50.......-.-60........70........80........90........100......-.110.......120.......130.......140.......150.......160.......170....-...-180.......190.......200.......210.......220.......230.......240--.........250....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MKTYKGYLIDLDGTMYNGTEKIEEACEFVRTLKDRGVPYLFVTNNSSRTPKQVADKLV-S-FDIPATEEQVFTTSMATAQHIAQQKKDASVYVIGEEGIRQAIEENGLTF-GGENADFVVVGIDRSITYEKFAVGCLAIRNGARFISTNGDIAIPTERGLLPGNGSLTSVLTVSTGVQP-VFI-GKPESIIMEQAMRVLGTDVSETLMVGDNYATDIMAGINAGMDTLLVHTGVTKREHMTDDME----KPTHAIDSLTEWIPYI
1 PsiBlast_PDB 94.3499%-105 - C2 -3PDW YUTF_BACSU A:[3-258] LKTYKGYLIDLDGTMYNGTEKIEEACEFVRTLKDRGVPYLFVTNNSSRTPKQVADKLV-S-FDIPATEEQVFTTSMATAQHIAQQKKDASVYVIGEEGIRQAIEENGLTF-GGENADFVVVGIDRSITYEKFAVGCLAIRNGARFISTNGDIAIPTERGLLPGNGSLTSVLTVSTGVQP-VFI-GKPESIIMEQAMRVLGTDVSETLMVGDNYATDIMAGINAGMDTLLVHTG------MTDDME----KPTHAIDSLTEWIPYI
38 HHSearch 93.87100%-101 - C2 -3PDW YUTF_BACSU A:[3-257] LKTYKGYLIDLDGTMYNGTEKIEEACEFVRTLKDRGVPYLFVTNNSSRTPKQVADKLV-S-FDIPATEEQVFTTSMATAQHIAQQKKDASVYVIGEEGIRQAIEENGLTF-GGENADFVVVGIDRSITYEKFAVGCLAIRNGARFISTNGDIAIPTERGLLPGNGSLTSVLTVSTGVQP-VFI-GKPESIIMEQAMRVLGTDVSETLMVGDNYATDIMAGINAGMDTLLVHTG------MTDDME----KPTHAIDSLTEWIPY-
2 PsiBlast_PDB 84.3161% -99 - C2 -4O8C - ? A:[7-258] MRKYNGYLIDLDGTMYRGTERIDAASGFIKELNRLHIPYLFVTNNSTRTPEQVADKLV-S-LDIPATPEQIFTSSMATANYVYDLDQNAMIYFIGEEGLYKALKEKGFSF-ADENADVVIVGLDREVTYEKLAVACLAVRNGAKLISTNGDLALPTERGFMPGNGAFTALISYSTQVKA-TFV-GKPEPIIMEQALKVLGTNKNETIMVGDNYDTDILAGIRAGLDTLLVHTGVTTVEKLKEYKQ----QPTYSMKSLDDW----
21 PsiBlast_CBE 83.5561% -96 - C2 -4O8C ? B:[7-258] MRKYNGYLIDLDGTMYRGTERIDAASGFIKELNRLHIPYLFVTNNSTRTPEQVADKLV-S-LDIPATPEQIFTSSMATANYVYDLDQNAMIYFIGEEGLYKALKEKGFSF-ADENADVVIVGLDREVTYEKLAVACLAVRNGAKLISTNGDLALPTERGFMPGNGAFTALISYSTQVKA-TFV-GKPEPIIMEQALKVLGTNKNETIMVGDNYDTDILAGIRAGLDTLLVHTGVTTVEKLKEYKQ----QPTYSMKSLDDW----
5 PsiBlast_PDB 83.5061% -97 - C2 -4IG4 - ? A:[1-252] MRKYNGYLIDLDGTMYRGTERIDAASGFIKELNRLHIPYLFVTNNSTRTPEQVADKLV-S-LDIPATPEQIFTSSMATANYVYDLDQSAMIYFIGEEGLYKALKEKGFSF-ADENADVVIVGLDREVTYEKLAVACLAVRNGAKLISTNGDLALPTERGFMPGNGAFTALISHSTQVKA-TFV-GKPEPIIMEQALKVLGTNKNETIMVGDNYDTDILAGIRAGLDTLLVHTGVTTVEKLKEYKQ----QPTYSMKSLDDW----
4 PsiBlast_PDB 82.8961%-100 - C- -4IFT - ? A:[1-252] MRKYNGYLIDLDGTMYRGTERIDAASGFIKELNRLHIPYLFVTNNSTRTPEQVADKLV-S-LDIPATPEQIFTSSMATANYVYDLDQNAMIYFIGEEGLYKALKEKGFSF-ADENADVVIVGLDREVTYEKLAVACLAVRNGAKLISTNGDLVLPTERGLMPGNGAFTALISHSTQVKA-TFV-GKPEPIIMEQALKVLGTNKNETIMVGDNYDTDILAGIRAGLDTLLVHTGVTTVEKLKEYKQ----QPTYSMKSLDDW----
3 PsiBlast_PDB 81.9761% -98 - C- -4KN8 - ? A:[1-252] MRKYNGYLIDLDGTMYRGTERIDAASGFIKELNRLHIPYLFVTNNSTRTPEQVADKLV-S-LDIPATPEQIFTSSMATANYVYDLDQNAMIYFIGEEGLYKALKEKGFSF-ADENADVVIVGLDREVTYEKLAVACLAVRNGAKLISTNGDLALPTERGFMPGNGAFTALISHSTQVKA-TFV-GKPEPIIMEQALKVLGTNKNETIMVGDNYDTDILAGIRAGLDTLLVHTGVTTVEKLKEYKQ----QPTYSMKSLDDW----
48 HHSearch 81.7261% -98 - C- -4KN8 - ? A:[1-254] MRKYNGYLIDLDGTMYRGTERIDAASGFIKELNRLHIPYLFVTNNSTRTPEQVADKLV-S-LDIPATPEQIFTSSMATANYVYDLDQNAMIYFIGEEGLYKALKEKGFSF-ADENADVVIVGLDREVTYEKLAVACLAVRNGAKLISTNGDLALPTERGFMPGNGAFTALISHSTQVKA-TFV-GKPEPIIMEQALKVLGTNKNETIMVGDNYDTDILAGIRAGLDTLLVHTGVTTVEKLKEYKQ----QPTYSMKSLDDWKF--
6 PsiBlast_PDB 76.1848%-113 - C2 -3EPR ? A:[5-253] ---YKGYLIDLDGTIYKGKSRIPAGERFIERLQEKGIPYMLVTNNTTRTPESVQEMLR-G-FNVETPLETIYTATMATVDYMNDMNRGKTAYVIGEEGLKKAIADAGYVE-DTKNPAYVVVGLDWNVTYDKLATATLAIQNGALFIGTNPDLNIPTERGLLPGAGSLNALLEAATRIKP-VFI-GKPNAIIMNKALEILNIPRNQAVMVGDNYLTDIMAGINNDIDTLLVTTGFTTVEEVPDLPI----QPSYVLASLDEW----
42 HHSearch 76.1748%-112 - C2 -3EPR ? A:[2-255] SLAYKGYLIDLDGTIYKGKSRIPAGERFIERLQEKGIPYMLVTNNTTRTPESVQEMLR-G-FNVETPLETIYTATMATVDYMNDMNRGKTAYVIGEEGLKKAIADAGYVE-DTKNPAYVVVGLDWNVTYDKLATATLAIQNGALFIGTNPDLNIPTERGLLPGAGSLNALLEAATRIKP-VFI-GKPNAIIMNKALEILNIPRNQAVMVGDNYLTDIMAGINNDIDTLLVTTGFTTVEEVPDLPI----QPSYVLASLDEWTF--
40 HHSearch 75.4230%-126 - C2 -2C4N NAGD_ECOLI A:[1-250] -MTIKNVICDIDGVLMHDNVAVPGAAEFLHGIMDKGLPLVLLTNYPSQTGQDLANRFA-T-AGVDVPDSVFYTSAMATADFLRRQ-EGKKAYVVGEGALIHELYKAGFTI-TDVNPDFVIVGETRSYNWDMMHKAAYFVANGARFIATNPDTHGRG---FYPACGALCAGIEKISGRKP-FYV-GKPSPWIIRAALNKMQAHSEETVIVGDNLRTDILAGFQAGLETILVLSGVSSLDDIDSMPF----RPSWIYPSVAEIDVI-
14 PsiBlast_PDB 72.5931%-112 - C2 -2C4N NAGD_ECOLI A:[2-246] --TIKNVICDIDGVLMHDNVAVPGAAEFLHGIMDKGLPLVLLTNYPSQTGQDLANRFA-T-AGVDVPDSVFYTSAMATADFLRRQEGKKA-YVVGEGALIHELYKAGFTI-TDVNPDFVIVGETRSYNWDMMHKAAYFVANGARFIATNPDT---HGRGFYPACGALCAGIEKISGRKP-FYV-GKPSPWIIRAALNKMQAHSEETVIVGDNLRTDILAGFQAGLETILVLSGVSSLDDIDSMPF----RPSWIYPSVAE-----
8 PsiBlast_PDB 71.6048% -38 - C2 -1YS9 - ? A:[3-252] ---YKGYLIDLDGTIYQGKNRIPAGERFIKRLQERGIPYLLVTNNTTRTPEMVQSMLA-NQFHVETSIETIYTATMATVDYMNDMNRGKTAYVIGETGLKSAIAAAGYVE-ELENPAYVVVGLDSQVTYEMLAIATLAIQKGALFIGTNPDLNIPTERGLMPGAGALNALLEAATRVKP-VFI-GKPNAIIMNKSLEVLGIQRSEAVMVGDNYLTDIMAGIQNDIATILVTTGFTRPEEVPTLPI----QPDHVLSSLDEW----
9 PsiBlast_PDB 71.1347% -38 - C2 -1WVI - ? A:[1002-1252] --TYKGYLIDLDGTIYKGKDRIPAGEDFVKRLQERQLPYILVTNNTTRTPEMVQEMLATS-FNIKTPLETIYTATLATIDYMNDMKRGKTAYVIGETGLKKAVAEAGYRE-DSENPAYVVVGLDTNLTYEKLTLATLAIQKGAVFIGTNPDLNIPTERGLLPGAGAILFLLEKATRVKP-III-GKPEAVIMNKALDRLGVKRHEAIMVGDNYLTDITAGIKNDIATLLVTTGFTKPEEVPALPI----QPDFVLSSLAEW----
46 HHSearch 71.1030% -77 * C2 *1VJR - ? A:[14-270] LDKIELFILDMDGTFYLDDSLLPGSLEFLETLKEKNKRFVFFTNNSSLGAQDYVRKLR-N-MGVDVPDDAVVTSGEITAEHMLKRFGRCRIFLLGTPQLKKVFEAYGHVI-DEENPDFVVLGFDKTLTYERLKKACILLRKGKFYIATHPDINCPSKEGPVPDAGSIMAAIEASTGRKPDLIA-GKPNPLVVDVISEKFGVPKERMAMVGDRLYTDVKLGKNAGIVSILVLTGETTPEDLERAET----KPDFVFKNLGELAKAV
7 PsiBlast_PDB 68.7850% -26 - C2 -1YDF ? A:[3-252] ---YKGYLIDLDGTIYKGKDRIPAGETFVHELQKRDIPYLFVTNNTTRTPESVKEMLAQN-FNIDTPLSTVYTATLATIDYMNDLGLEKTVYVVGEAGLKEAIKAAGYVE-DKEKPAYVVVGLDWQVDYEKFATATLAIQKGAHFIGTNPDLNIPTERGLLPGAGSLITLLEVATRVKP-VYI-GKPNAIIMDKAVEHLGLEREELIMVGDNYLTDIRAGIDNGIPTLLVTTGFTKAEEVAGLPI----APTHVVSSLAEW----
23 PsiBlast_CBE 68.0936% -40 - C2 -4JDP ? B:[24-282] MPDKKGYIIDIDGVIGKSVTPIPEGVEGVKKLKELGKKIIFVSNNSTRSRRILLERLR-S-FGLEVGEDEILVATYATARFIAREKPNAKVFTTGEEGLIEELRLAGLEIVDYDEAEYLVVGSNRKINFELMTKALRACLRGIRYIATNPDRIFPAEDGPIPGTGMIIGALYWMTGREPDVVV-GKPSEVIMREALDILGLDAKDVAVVGDQIDVDVAAGKAIGAETVLVLTGVTTRENLDQMIERHGLKPDYVFNSLKDMV---
16 PsiBlast_PDB 67.9631% -73 - C2 -1VJR - ? A:[20-266] ------FILDMDGTFYLDDSLLPGSLEFLETLKEKNKRFVFFTNNSSLGAQDYVRKLR-N-MGVDVPDDAVVTSGEITAEHMLKRFGRCRIFLLGTPQLKKVFEAYGHVI-DEENPDFVVLGFDKTLTYERLKKACILLRKGKFYIATHPDINCPSKEGPVPDAGSIMAAIEASTGRKP-DLIAGKPNPLVVDVISEKFGVPKERMAMVGDRLYTDVKLGKNAGIVSILVLTGETTPEDLERAET----KPDFVFKNLGEL----
11 PsiBlast_PDB 67.1836% -37 - C2 -4JDP ? A:[24-282] MPDKKGYIIDIDGVIGKSVTPIPEGVEGVKKLKELGKKIIFVSNNSTRSRRILLERLR-S-FGLEVGEDEILVATYATARFIAREKPNAKVFTTGEEGLIEELRLAGLEIVDYDEAEYLVVGSNRKINFELMTKALRACLRGIRYIATNPDRIFPAEDGPIPGTGMIIGALYWMTGREPDVVV-GKPSEVIMREALDILGLDAKDVAVVGDQIDVDVAAGKAIGAETVLVLTGVTTRENLDQMIERHGLKPDYVFNSLKDMV---
22 PsiBlast_CBE 66.9246% -28 - C2 -1YV9 ? B:[5-254] ---YQGYLIDLDGTIYLGKEPIPAGKRFVERLQEKDLPFLFVTNNTTKSPETVAQRLA-NEFDIHVPASLVYTATLATIDYMKEANRGKKVFVIGEAGLIDLILEAGFEW-DETNPDYVVVGLDTELSYEKVVLATLAIQKGALFIGTNPDKNIPTERGLLPGAGSVVTFVETATQTKP-VYI-GKPKAIIMERAIAHLGVEKEQVIMVGDNYETDIQSGIQNGIDSLLVTSGFTPKSAVPTLPT----PPTYVVDSLDEW----