@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu32550: (2016-07-24 )
MASLTFEHVKKSYHSQLTVKDFDLDVKDKELLVLVGPSGCGKSTTLRMVAGLESISEGNLLIDGERVNDLPPKERDIAMVFQNYALYPHMTVFDNMAFGLKLRKMAKQEIAERVHAAARILEIEHLLKRKPKALSGGQRQRVALGRSIVREPKVFLMDEPLSNLDAKLRVTMRTEISKLHQRLEATIIYVTHDQTEAMTMGDRIVVMNEGEIQQVAKPHDIYHYPANLFVAGFIGSPGMNFLKGIIEQQHGELFFTNSSIRLHIPEEKAKRLKEKGYAGEQMIAGVRPEHITQMTGNDQLFDSVFQANVEVNENLGSELIVHVMAGDERLKVRLDGNTRIDAGDSIQLSVKMDHVVFFDAETEEAVY

Atome Classification :

(46 SA) .........10..-..-----.----...20........30........40........50.......------.60...----...----.----.---70---....-----..-...80...--.....90........-100.......110.......120..-.....----130--...-----------......140.......150.......160.......170.......180..---.....190.......200.......210.......220.......230.......240.-----..-.---...250.-.....--.-260.......270.......280.......--290.......-300-.----........310.......320...-...--.-330.......340.......350.......360.....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MASLTFEHVKKSY-HS-----Q----LTVKDFDLDVKDKELLVLVGPSGCGKSTTLRMVAGLESISEG------NLLIDG----ERV----N----D---L----PPKE-----RD-IAMVFQNY--ALYPHMTVFDNMAFG-LKLRKMAKQEIAERVHAAARILEIE-HLLKR----K----PKA-----------LSGGQRQRVALGRSIVREPKVFLMDEPLSNLDAKLRVTMRTEISKLHQRLE---ATIIYVTHDQTEAMTMGDRIVVMNEGEIQQVAKPHDIYHYPANLFVAGFIGSPGMNFLK-----GI-I---EQQHGEL-FFTNS--S-IRLHIPEEKAKRLKEKGYAGEQMIAGVRPE--HITQMTGNDQ-L---F----DSVFQANVEVNENLGSELIVHVMA-GDE--R-LKVRLDGNTRIDAGDSIQLSVKMDHVVFFDAETEEAVY
6 PsiBlast_PDB 84.1848%-104 - C1 -1V43 - ? A:[10-372] MVEVKLENLTKRF-GN-----F----TAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEG------RIYFGD----RDV----T----Y---L----PPKD-----RN-ISMVFQ--------HMTVYENIAFP-L--KKFPKDEIDKRVRWAAELLQIE-ELLNR----Y----PAQ-----------LSGGQRQRVAVARAIVVEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKLK---VTTIYVTHDQVEAMTMGDRIAVMNRGQLLQIGSPTEVYLRPNSVFVATFIGAPEMN---------I-L---EVSVGDG-YLEGR--G-FRIELPQ--MDLLKD--YVGKTVLFGIRPE--HMT-VEGV--------HMKRTARLIGKVDFVEALGTDTILHVKF-GDE--L-VKVKLPGHIPIEPGREVKVIMDLDMIHVFDKDTEKAI-
3 PsiBlast_PDB 83.1251% -78 - C1 -4XIG - ? S:[2-363] VASVSIQNVVKRY-DK-----T----TVVHGVSLDIEPGEFVVLVGPSGCGKSTTLRMVAGLEEISGG------TIRIDG----RVI----N----D---L----APKD-----RD-VAMVFQNY--ALYPHLNVRDNISFG-LRLKRTKKSVIDAAVKTAADILGLQ-PLLER----K----PSD-----------LSGGQRQRVAMGRAIVRDPKVFLFDQPLSNLDAKLRTQMRAEIKRLHQRLG---TTVIYVTHDQVEAMTLADRIVVMRDGLIEQIGKPMDLFLHPANTFVASFIGSPPMNLMP-----AR-IAVDSTQHVEL----NG--G-NRISLLPRAGTHLA----PGQEVVFGIRPE--DVT-LDGVEG-S---E----RAQIKATVDIVEPLGSESILHATV-GDH--S-LVVKVGGLNEVHPGDPVTLHVDLTRVHLFDAQSQASIY
119 HHSearch 83.0742%-115 - C1 -2IT1 - ? A:[1-356] MVEIKLENIVKKF-GN-----F----TALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSG------KIYFDE----KDV----T----E---L----PPKD-----RN-VGLVFQNW--ALYPHMTVYKNIAFP-LELRKAPREEIDKKVREVAKMLHID-KLLNR----Y----PWQ-----------LSGGQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKELG---ITTVYVTHDQAEALAMADRIAVIREGEILQVGTPDEVYYKPKYKFVGGFLGNPPMNFVE-----AK-V---EDGKLV----ITE--K-SKLPIPKQYV--EIVKETGITEVIIGFRPH--DAEIVKGE------------GEGIVGEVYSFEPLGREQIVTVSV-NDS--I-VKVFAPEGEHFSFGEKVTIKVKEELLVLFDKKTEKA--
5 PsiBlast_PDB 82.8948%-101 - C1 -1VCI ? A:[10-372] MVEVKLENLTKRF-GN-----F----TAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEG------RIYFGD----RDV----T----Y---L----PPKD-----RN-ISMVFQ--------HMTVYENIAFP-L--KKFPKDEIDKRVRWAAELLQIE-ELLNR----Y----PAQ-----------LSGGQRQRVAVARAIVVEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKLK---VTTIYVTHDQVEAMTMGDRIAVMNRGQLLQIGSPTEVYLRPNSVFVATFIGAPEMN---------I-L---EVSVGDG-YLEGR--G-FRIELPQ--MDLLKD--YVGKTVLFGIRPE--HMT-VEGV--------HMKRTARLIGKVDFVEALGTDTILHVKF-GDE--L-VKVKLPGHIPIEPGREVKVIMDLDMIHVFDKDTEKAI-
1 PsiBlast_PDB 82.8551% -73 - C1 -4TQU - ? S:[2-363] VASVSIQNVVKRY-DK-----T----TVVHGVSLDIEPGEFVVLVGPSGCGKSTTLRMVAGLEEISGG------TIRIDG----RVI----N----D---L----APKD-----RD-VAMVFQNY--ALYPHLNVRDNISFG-LRLKRTKKSVIDAAVKTAADILGLQ-PLLER----K----PSD-----------LSGGQRQRVAMGRAIVRDPKVFLFDQPLSNLDAKLRTQMRAEIKRLHQRLG---TTVIYVTHDQVEAMTLADRIVVMRDGLIEQIGKPMDLFLHPANTFVASFIGSPPMNLMP-----AR-IAVDSTQHVEL----NG--G-NRISLLPRAGTHLA----PGQEVVFGIRPE--DVT-LDGVEG-S---E----RAQIKATVDIVEPLGSESILHATV-GDH--S-LVVKVGGLNEVHPGDPVTLHVDLTRVHLFDAQSQASIY
4 PsiBlast_PDB 82.3951% -79 - C1 -4XTC - ? S:[2-363] VASVSIQNVVKRY-DK-----T----TVVHGVSLDIEPGEFVVLVGPSGCGKSTTLRMVAGLEEISGG------TIRIDG----RVI----N----D---L----APKD-----RD-VAMVFQNY--ALYPHLNVRDNISFG-LRLKRTKKSVIDAAVKTAADILGLQ-PLLER----K----PSD-----------LSGGQRQRVAMGRAIVRDPKVFLFDQPLSNLDAKLRTQMRAEIKRLHQRLG---TTVIYVTHDQVEAMTLADRIVVMRDGLIEQIGKPMDLFLHPANTFVASFIGSPPMNLMP-----AR-IAVDSTQHVEL----NG--G-NRISLLPRAGTHLA----PGQEVVFGIRPE--DVT-LDGVEG-S---E----RAQIKATVDIVEPLGSESILHATV-GDH--S-LVVKVGGLNEVHPGDPVTLHVDLTRVHLFDAQSQASIY
117 HHSearch 82.0750% -88 - C1 -4TQU - ? S:[2-363] VASVSIQNVVKRY-DK-----T----TVVHGVSLDIEPGEFVVLVGPSGCGKSTTLRMVAGLEEISGG------TIRIDG----RVI----N----D---L----APKD-----RD-VAMVFQNY--ALYPHLNVRDNISFG-LRLKRTKKSVIDAAVKTAADILGLQ-PLLER----K----PSD-----------LSGGQRQRVAMGRAIVRDPKVFLFDQPLSNLDAKLRTQMRAEIKRLHQRLG---TTVIYVTHDQVEAMTLADRIVVMRDGLIEQIGKPMDLFLHPANTFVASFIGSPPMNLMP-----AR-I---AVDSTQH--VELNG-G-NRISLLPRA----GTHLAPGQEVVFGIRPE--DVTLDGVEG--S---E----RAQIKATVDIVEPLGSESILHATV-GDH--S-LVVKVGGLNEVHPGDPVTLHVDLTRVHLFDAQSQASIY
123 HHSearch 82.0448% -80 - C1 -3RLF MALK_ECOLI A:[2-361] -ASVQLQNVTKAW-GE-----V----VVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSG------DLFIGE----KRM----N----D---T----PPAE-----RG-VGMVFQSY--ALYPHLSVAENMSFG-LKLAGAKKEVINQRVNQVAEVLQLA-HLLDR----K----PKA-----------LSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLG---RTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLP-----VK-V---TATAIDQVQVELPMPNRQQVWLPVE-----SRDVQVGANMSLGIRPE--HLLPSDIA------------DVILEGEVQVVEQLGNETQIHIQI-PSIRQN-LVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTA---
2 PsiBlast_PDB 81.3451% -76 - C1 -4TQV - ? C:[2-363] VASVSIQNVVKRY-DK-----T----TVVHGVSLDIEPGEFVVLVGPSGCGKSTTLRMVAGLEEISGG------TIRIDG----RVI----N----D---L----APKD-----RD-VAMVFQNY--ALYPHLNVRDNISFG-LRLKRTKKSVIDAAVKTAADILGLQ-PLLER----K----PSD-----------LSGGQRQRVAMGRAIVRDPKVFLFDQPLSNLDAKLRTQMRAEIKRLHQRLG---TTVIYVTHDQVEAMTLADRIVVMRDGLIEQIGKPMDLFLHPANTFVASFIGSPPMNLMP-----AR-IAVDSTQHVEL----NG--G-NRISLLPRAGTHLA----PGQEVVFGIRPE--DVT-LDGVEG-S---E----RAQIKATVDIVEPLGSESILHATV-GDH--S-LVVKVGGLNEVHPGDPVTLHVDLTRVHLFDAQSQASIY
36 PsiBlast_CBE 81.2041% -93 - C1 -2IT1 ? B:[2-357] -VEIKLENIVKKF-GN-----F----TALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSG------KIYFDE----KDV----T----E---L----PPKD-----RN-VGLVFQNW--ALYPHMTVYKNIAFP-LELRKAPREEIDKKVREVAKMLHID-KLLNR----Y----PWQ-----------LSGGQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKELG---ITTVYVTHDQAEALAMADRIAVIREGEILQVGTPDEVYYKPKYKFVGGFLGNPPMNFVE-----AK-V---ED--GKL-VITEK--S--KLPIPKQYVEIVKETGIT--EVIIGFRPH--DAEIVKGEGEGI---V----GEVYSF-----EPLGREQIVTVSV-NDS--I-VKVFAPEGEHFSFGEKVTIKVKEELLVLFDKKTEKAL-
118 HHSearch 78.0349% -84 - C1 -1V43 - ? A:[10-372] MVEVKLENLTKRF-GN-----F----TAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEG------RIYFGD----RDV----T----Y---L----PPKD-----RN-ISMVFQ--------HMTVYENIAFP-L--KKFPKDEIDKRVRWAAELLQIE-ELLNR----Y----PAQ-----------LSGGQRQRVAVARAIVVEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKLK---VTTIYVTHDQVEAMTMGDRIAVMNRGQLLQIGSPTEVYLRPNSVFVATFIGAPEMNILE-----VS-V---GDGYLE-----GR--G-FRIELPQ--M--DLLKDYVGKTVLFGIRPE--HMTVEGV-----HMKR----TARLIGKVDFVEALGTDTILHVKF-GDE--L-VKVKLPGHIPIEPGREVKVIMDLDMIHVFDKDTEKAI-
7 PsiBlast_PDB 77.5747% 15 - C1 -2D62 ? A:[5-375] -AEVKLINIWKRF-GD-----V----TAVKDLSLEIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTRGQIYIEDNLVADP----EKG----V----F---V----PPKE-----RD-VAMVFQSY--ALYPHMTVYDNIAFP-LKLRKVPKQEIDKRVREVAEMLGLT-ELLNR----K----PRE-----------LSGGQRQRVALGRAIIRRPKVFLMDEPLSNLDAKLRVKMRAELKKLQRQLG---VTTIYVTHDQVEAMTMGDRIAVMNKGELQQVGTPDEVYYKPVNTFVAGFIGSPPMNFLD-----AT-I---TDDG----FLDFG--E-FKLKLLQDQFEVLEEENMVGKEVIFGIRPEDVHDASFTHIDV-P---E----ENTVKATVDIIENLGGEKIVHLRR-GNI--S-FTAKFPKESKVREGDEVSVVFDMKKIHIFRKDTEKAIF
120 HHSearch 77.1444% -73 - C1 -2YYZ ? A:[2-358] -PSIRVVNLKKYF-GK-----V----KAVDGVSFEVKDGEFVALLGPSGCGKTTTLLMLAGIYKPTSG------EIYFDD----VLV----N----D---I----PPKY-----RE-VGMVFQNY--ALYPHMTVFENIAFP-LRARRISKDEVEKRVVEIARKLLID-NLLDR----K----PTQ-----------LSGGQQQRVALARALVKQPKVLLFDEPLSNLDANLRMIMRAEIKHLQQELG---ITSVYVTHDQAEAMTMASRIAVFNQGKLVQYGTPDEVYDSPKNMFVASFIGNPPTNFLR-----DF-S---VSVENKQTILKRD--D-VIIKLPE-------PVDVKLKEVVVGIRPE--HCRISRER-------V----ENSIPGVVYVVEPLGRDIIVNVKT-EKG--EIIKVFGDTGKAPQPGENVFLVPDLRKIHLFNPETEETI-
19 PsiBlast_PDB 76.5052%-107 - C1 -3RLF MALK_ECOLI A:[2-318] -ASVQLQNVTKAW-GE-----V----VVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSG------DLFIGE----KRM----N----D---T----PPAE-----RG-VGMVFQSY--ALYPHLSVAENMSFG-LKLAGAKKEVINQRVNQVAEVLQLA-HLLDR----K----PKA-----------LSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLG---RTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATA-I---DQVQVEL-PMPNR--Q--QVWLPVE-----SRDVQVGANMSLGIRPE--HLLP----SD-I---A----DVILEGEVQVVEQLGNETQIHI------------------------------------------------
18 PsiBlast_PDB 75.8252%-104 - C1 -3PUX MALK_ECOLI A:[2-318] -ASVQLQNVTKAW-GE-----V----VVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSG------DLFIGE----KRM----N----D---T----PPAE-----RG-VGMVFQSY--ALYPHLSVAENMSFG-LKLAGAKKEVINQRVNQVAEVLQLA-HLLDR----K----PKA-----------LSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLG---RTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATA-I---DQVQVEL-PMPNR--Q--QVWLPVE-----SRDVQVGANMSLGIRPE--HLLP----SD-I---A----DVILEGEVQVVEQLGNETQIHI------------------------------------------------
16 PsiBlast_PDB 75.1952%-105 - C1 -3PUV MALK_ECOLI A:[2-318] -ASVQLQNVTKAW-GE-----V----VVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSG------DLFIGE----KRM----N----D---T----PPAE-----RG-VGMVFQSY--ALYPHLSVAENMSFG-LKLAGAKKEVINQRVNQVAEVLQLA-HLLDR----K----PKA-----------LSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLG---RTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATA-I---DQVQVEL-PMPNR--Q--QVWLPVE-----SRDVQVGANMSLGIRPE--HLLP----SD-I---A----DVILEGEVQVVEQLGNETQIHI------------------------------------------------
35 PsiBlast_CBE 74.9343% -68 - C1 -2YYZ ? A:[2-358] -PSIRVVNLKKYF-GK-----V----KAVDGVSFEVKDGEFVALLGPSGCGKTTTLLMLAGIYKPTSG------EIYFDD----VLV----N----D---I----PPKY-----RE-VGMVFQNY--ALYPHMTVFENIAFP-LRARRISKDEVEKRVVEIARKLLID-NLLDR----K----PTQ-----------LSGGQQQRVALARALVKQPKVLLFDEPLSNLDANLRMIMRAEIKHLQQELG---ITSVYVTHDQAEAMTMASRIAVFNQGKLVQYGTPDEVYDSPKNMFVASFIGNPPTNFLR-----DFSV---SVENKQT-ILKRD--D-VIIKLPEPVDVKLKE-------VVVGIRPE--HCR--ISRER-V---E----NSI-PGVVYVVEPLGRDIIVNVKTEKGE--I-IKVFGDTGKAPQPGENVFLVPDLRKIHLFNPETEETI-
23 PsiBlast_CBE 74.3352%-104 - C1 -3RLF MALK_ECOLI B:[2-318] -ASVQLQNVTKAW-GE-----V----VVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSG------DLFIGE----KRM----N----D---T----PPAE-----RG-VGMVFQSY--ALYPHLSVAENMSFG-LKLAGAKKEVINQRVNQVAEVLQLA-HLLDR----K----PKA-----------LSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLG---RTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATA-I---DQVQVEL-PMPNR--Q--QVWLPVE-----SRDVQVGANMSLGIRPE--HLLP----SD-I---A----DVILEGEVQVVEQLGNETQIHI------------------------------------------------
13 PsiBlast_PDB 74.2852%-103 - C1 -3PUY MALK_ECOLI A:[2-318] -ASVQLQNVTKAW-GE-----V----VVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSG------DLFIGE----KRM----N----D---T----PPAE-----RG-VGMVFQSY--ALYPHLSVAENMSFG-LKLAGAKKEVINQRVNQVAEVLQLA-HLLDR----K----PKA-----------LSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLG---RTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATA-I---DQVQVEL-PMPNR--Q--QVWLPVE-----SRDVQVGANMSLGIRPE--HLLP----SD-I---A----DVILEGEVQVVEQLGNETQIHI------------------------------------------------
22 PsiBlast_CBE 74.2252%-104 - C1 -4KI0 MALK_ECOLI A:[2-318] -ASVQLQNVTKAW-GE-----V----VVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSG------DLFIGE----KRM----N----D---T----PPAE-----RG-VGMVFQSY--ALYPHLSVAENMSFG-LKLAGAKKEVINQRVNQVAEVLQLA-HLLDR----K----PKA-----------LSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLG---RTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATA-I---DQVQVEL-PMPNR--Q--QVWLPVE-----SRDVQVGANMSLGIRPE--HLLP----SD-I---A----DVILEGEVQVVEQLGNETQIHI------------------------------------------------
124 HHSearch 50.8331% -10 - C1 -3FVQ FBPC_NEIG1 A:[2-349] TAALHIGHLSKSF-QN-----T----PVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSG------EISLSG----KTI----FSKNTN---L----PVRE-----RR-LGYLVQEG--VLFPHLTVYRNIAYG-LGNGKGRTAQERQRIEAMLELTGIS-ELAGR----Y----PHE-----------LSGGQQQRAALARALAPDPELILLDEPFSALDEQLRRQIREDMIAALRANG---KSAVFVSHDREEALQYADRIAVMKQGRILQTASPHELYRQPADLDAALFIGE--GIVFP-----AA-L---NADGTAD--CR----L-GRLPVQ--------SGAPAGTRGTLLIRPE--QYSLHPHSA------P----AASIHAVVLKTTPKARHTEISLRA-GQT--V-LTLNL-----LSDGISAVLHLDGPALFFPG--------
50 PsiBlast_CBE 46.2037% -16 - C1 -3FVQ FBPC_NEIG1 A:[3-245] -AALHIGHLSKSF-QN-----T----PVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSG------EISLSG----KTIFSKNT----N---L----PVRE-----RR-LGYLVQEG--VLFPHLTVYRNIAYG-LGNGKGRTAQERQRIEAMLELTGIS-ELAGR----Y----PHE-----------LSGGQQQRAALARALAPDPELILLDEPFSALDEQLRRQIREDMIAALRANG---KSAVFVSHDREEALQYADRIAVMKQGRILQTASPHELYRQPADLDAALFIG---------------------------------------------------------------------------------------------------------------------------------------------------------------
49 PsiBlast_CBE 44.5137% -17 - C1 -3FVQ FBPC_NEIG1 B:[3-240] -AALHIGHLSKSF-QN-----T----PVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSG------EISLSG----KTIFSKNT----N---L----PVRE-----RR-LGYLVQEG--VLFPHLTVYRNIAYG-LGNGKGRTAQERQRIEAMLELTGIS-ELAGR----Y----PHE-----------LSGGQQQRAALARALAPDPELILLDEPFSALDEQLRRQIREDMIAALRANG---KSAVFVSHDREEALQYADRIAVMKQGRILQTASPHELYRQPADLDAALFIG---------------------------------------------------------------------------------------------------------------------------------------------------------------
72 PsiBlast_CBE 40.3735% -34 - C1 -4YMV ? A:[7-229] --------VYKNF-GS-----L----EVLKGVTLKVNKGEVVVIIGPSGSGKSTLLRCINLLEEPTKG------EVFIDG----VKI----NNGKVN---I----NKVR-----QK-VGMVFQHF--NLFPHLTAIENITLAPVKVKKMNKKEAEE---LAVDLLAKV-GLLDK----KDQY-PIK-----------LSGGQKQRLAIARALAMQPEVMLFDEPTSALDPE----MVKEVLNVMKQLANEGMTMVVVTHEMGFAREVGDRVIFMDDGVIVEEGTPEEIFYRAKN-----------------------------------------------------------------------------------------------------------------------------------------------------------------------
74 PsiBlast_CBE 40.3235% -37 - C1 -4YMU ? A:[7-229] --------VYKNF-GS-----L----EVLKGVTLKVNKGEVVVIIGPSGSGKSTLLRCINLLEEPTKG------EVFIDG----VKI----NNGKVN---I----NKVR-----QK-VGMVFQHF--NLFPHLTAIENITLAPVKVKKMNKKEAEE---LAVDLLAKV-GLLDK----KDQY-PIK-----------LSGGQKQRLAIARALAMQPEVMLFDEPTSALDPE----MVKEVLNVMKQLANEGMTMVVVTHEMGFAREVGDRVIFMDDGVIVEEGTPEEIFYRAKN-----------------------------------------------------------------------------------------------------------------------------------------------------------------------
71 PsiBlast_CBE 40.1735% -37 - C1 -4YMV ? J:[7-229] --------VYKNF-GS-----L----EVLKGVTLKVNKGEVVVIIGPSGSGKSTLLRCINLLEEPTKG------EVFIDG----VKI----NNGKVN---I----NKVR-----QK-VGMVFQHF--NLFPHLTAIENITLAPVKVKKMNKKEAEE---LAVDLLAKV-GLLDK----KDQY-PIK-----------LSGGQKQRLAIARALAMQPEVMLFDEPTSALDPE----MVKEVLNVMKQLANEGMTMVVVTHEMGFAREVGDRVIFMDDGVIVEEGTPEEIFYRAKN-----------------------------------------------------------------------------------------------------------------------------------------------------------------------
73 PsiBlast_CBE 40.0735% -35 - C1 -4YMU ? J:[7-229] --------VYKNF-GS-----L----EVLKGVTLKVNKGEVVVIIGPSGSGKSTLLRCINLLEEPTKG------EVFIDG----VKI----NNGKVN---I----NKVR-----QK-VGMVFQHF--NLFPHLTAIENITLAPVKVKKMNKKEAEE---LAVDLLAKV-GLLDK----KDQY-PIK-----------LSGGQKQRLAIARALAMQPEVMLFDEPTSALDPE----MVKEVLNVMKQLANEGMTMVVVTHEMGFAREVGDRVIFMDDGVIVEEGTPEEIFYRAKN-----------------------------------------------------------------------------------------------------------------------------------------------------------------------
79 PsiBlast_CBE 39.8533% -25 - C1 -4U00 ? A:[5-229] ---IRIRNLHKWF-GP-----L----HVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEG------EVVVDG----LSV----K----DDRAL----REIR-----RE-VGMVFQQF--NLFPHMTVLENVTLAPMRVRRWPREKAEKKALELLERVGIL-DQARK----Y----PAQ-----------LSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQG-G---MTMVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEEIFTRP-------------------------------------------------------------------------------------------------------------------------------------------------------------------------
132 HHSearch 34.5230% 40 - C1 -4MKI ECFA2_CALS4 B:[5-240] -MPIKVENVSFIY-NEGTPYAT----VALKDINFSIDDEEFVGIIGHTGSGKSTLIQQLNGLLKPSKG------KIYING----IDI----T----D---KKVSLKDIR-----KQ-VGLVFQYPEYQLFE-ETVFKDIAFG-PSNLGLSEEEVKERVYEAMEIVGISKELADK----S----PFE-----------LSGGQKRRVAIAGILAMRPKILILDEPTAGLDPKGKQEILNKIKEIHDKYK---MITILVSHNMEDIARIADKIIVMNRGKIELIGTPREVFREAE------------------------------------------------------------------------------------------------------------------------------------------------------------------------
82 PsiBlast_CBE 34.3932% 36 - C1 -3TIF Y796_METJA B:[2-228] ---VKLKNVTKTY-KM-----GEEIIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEG------EVYIDN----IKT----N----D---L----DDDELTKIRRDKIGFVFQQF--NLIPLLTALENVELP-LIFKYRGAMSGEERRKRALECLKMA-ELEERFANHK----PNQ-----------LSGGQQQRVAIARALANNPPIILADQPTWALDSKTGEKIMQLLKKLNEEDG---KTVVVVTHDINVA-RFGERIIYLKDGEVEREEK---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
68 PsiBlast_CBE 34.0136% -17 - C1 -2OLK ? A:[29-250] -------QLKKSF-GS-----L----EVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEG------EIIIDGINLKAKD----T----N---L----NKVR-----EE-VGMVFQRF--NLFPHMTVLNNITLAPMKVRKWPR----EKAEAKAMELLDK-VGLKD----KAHAYPDS-----------LSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANE-G---MTMVVVTHEMGFAREVGDRVLFMDGGYIIEEGKPEDLFDRP-------------------------------------------------------------------------------------------------------------------------------------------------------------------------
57 PsiBlast_CBE 33.7236% -10 - C1 -3C4J ? B:[29-250] -------QLKKSF-GS-----L----EVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEG------EIIIDGINLKAKD----T----N---L----NKVR-----EE-VGMVFQRF--NLFPHMTVLNNITLAPMKVRKWPR----EKAEAKAMELLDK-VGLKD----KAHAYPDS-----------LSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANE-G---MTMVVVTHEMGFAREVGDRVLFMDGGYIIEEGKPEDLFDRP-------------------------------------------------------------------------------------------------------------------------------------------------------------------------
55 PsiBlast_CBE 33.6636% -18 - C1 -3C41 ? K:[8-229] -------QLKKSF-GS-----L----EVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEG------EIIIDGINLKAKD----T----N---L----NKVR-----EE-VGMVFQRF--NLFPHMTVLNNITLAPMKVRKWPR----EKAEAKAMELLDK-VGLKD----KAHAYPDS-----------LSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANE-G---MTMVVVTHEMGFAREVGDRVLFMDGGYIIEEGKPEDLFDRP-------------------------------------------------------------------------------------------------------------------------------------------------------------------------
66 PsiBlast_CBE 33.5036% -17 - C1 -2OLK ? C:[29-250] -------QLKKSF-GS-----L----EVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEG------EIIIDGINLKAKD----T----N---L----NKVR-----EE-VGMVFQRF--NLFPHMTVLNNITLAPMKVRKWPR----EKAEAKAMELLDK-VGLKD----KAHAYPDS-----------LSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANE-G---MTMVVVTHEMGFAREVGDRVLFMDGGYIIEEGKPEDLFDRP-------------------------------------------------------------------------------------------------------------------------------------------------------------------------
80 PsiBlast_CBE 33.1532% 31 - C1 -1L2T Y796_METJA B:[2-228] ---IKLKNVTKTY-KM-----GEEIIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEG------EVYIDN----IKT----N----D---L----DDDELTKIRRDKIGFVFQQF--NLIPLLTALENVELP-LIFKYRGAMSGEERRKRALECLKMA-ELEERFANHK----PNQ-----------LSGGQQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLNEEDG---KTVVVVTHDINVA-RFGERIIYLKDGEVEREEK---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------