@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu33910: (2016-07-27 )
MSKKPAALIILDGFGLRNETVGNAVALAKKPNFDRYWNQYPHQTLTASGEAVGLPEGQMGNSEVGHLNIGAGRIVYQSLTRVNVAIREGEFERNQTFLDAISNAKENNKALHLFGLLSDGGVHSHINHLFALLKLAKKEGLTKVYIHGFLDGRDVGPQTAKTYINQLNDQIKEIGVGEIASISGRYYSMDRDKRWDRVEKAYRAMAYGEGPSYRSALDVVDDSYANGIYDEFVIPSVITKENGEPVAKIQDGDSVIFYNFRPDRAIQISNTFTNKDFRDFDRGENYPKNLYFVCLTHFSETVDGYVAFKPINLDNTVGEVLSQHGLKQLRIAETEKYPHVTFFMSGGREAEFPGEERILINSPKVATYDLKPEMSAYEVKDALVKEIEADKHDAIILNFANPDMVGHSGMVEPTIKAIEAVDECLGEVVDAILAKGGHAIITADHGNADILITESGEPHTAHTTNPVPVIVTKEGITLREGGILGDLAPTLLDLLGVEKPKEMTGTSLIQK

Atome Classification :

(20 SA) .........10........20........30........40.-.-......50....-...-.60........70........80........90........100.......110.......120.......130.......140.......150.......160......---.---170...-.---...180..-...-..190.-.......200.......210.......220--.....--.--..230.......240.......250.......260.......270.......280...-....290.......300.--.......310.......320.......330.......340.......350.--......360..-.....370.......380......--.390.......400.-......----------------------------------------------------------410.......420.......430..----.....440.......450...----------.--.------------..460.......470.....-------..-------480-------.......490.......500.......510
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MSKKPAALIILDGFGLRNETVGNAVALAKKPNFDRYWNQYPH-Q-TLTASGEAVGLP-EGQ-MGNSEVGHLNIGAGRIVYQSLTRVNVAIREGEFERNQTFLDAISNAKENNKALHLFGLLSDGGVHSHINHLFALLKLAKKEGLTKVYIHGFLDGRDVGPQTAKTYINQLN---D---QIKEIG-V---GEIASISG-RYY-SMDR-D-KRWDRVEKAYRAMAYGEGPSYRSALDVVD---DSYAN--G--IYDEFVIPSVITKENGEPVAKIQDGDSVIFYNFRPDRAIQISNTFTNKDFRDFDRGEN-YPKNLYFVCLTHFSET-V--DGYVAFKPINLDNTVGEVLSQHGLKQLRIAETEKYPHVTFFMSGGREAEFP--GEERILINSPK-VATYDLKPEMSAYEVKDALVKEIE--ADKHDAIILNFANPD-MVGHSG----------------------------------------------------------MVEPTIKAIEAVDECLGEVVDAILA----KGGHAIITADHGNADILITES----------G--E------------PHTAHTTNPVPVIVTKEGIT-------LR-------EGG-------ILGDLAPTLLDLLGVEKPKEMTGTSLIQK
45 Fugue 97.2580% -83 - C4 -1EJJ GPMI_GEOSE A:[3-510] --KKPVALIILDGFALRDETYGNAVAQANKPNFDRYWNEYPH-T-TLKACGEAVGLP-EGQ-MGNSEVGHLNIGAGRIVYQSLTRINIAIREGEFDRNETFLAAMNHVKQHGTSLHLFGLLSDGGVHSHIHHLYALLRLAAKEGVKRVYIHGFLDGRDVGPQTAPQYIKELQ---E---KIKEYG-V---GEIATLSG-RYY-SMDR-D-KRWDRVEKAYRAMVYGEGPTYRDPLECIE---DSYKH--G--IYDEFVLPSVIVREDGRPVATIQDNDAIIFYNFRPDRAIQISNTFTNEDFREFDRGPK-HPKHLFFVCLTHFSET-V--AGYVAFKPTNLDNTIGEVLSQHGLRQLRIAETEKYPHVTFFMSGGREEEFP--GEDRILINSPK-VPTYDLKPEMSAYEVTDALLKEIE--ADKYDAIILNYANPD-MVGHSG----------------------------------------------------------KLEPTIKAVEAVDECLGKVVDAILA----KGGIAIITADHGNADEVLTPD----------G--K------------PQTAHTTNPVPVIVTKKGIK-------LR-------DGG-------ILGDLAPTMLDLLGLPQPKEMTGKSLIV-
3 PsiBlast_PDB 96.1080% -81 - C4 -1O98 GPMI_GEOSE A:[2-510] -SKKPVALIILDGFALRDETYGNAVAQANKPNFDRYWNEYPH-T-TLKACGEAVGLP-EGQ-MGNSEVGHLNIGAGRIVYQSLTRINIAIREGEFDRNETFLAAMNHVKQHGTSLHLFGLLSDGGVHSHIHHLYALLRLAAKEGVKRVYIHGFLDGRDVGPQTAPQYIKELQ---E---KIKEYG-V---GEIATLSG-RYY-SMDR-D-KRWDRVEKAYRAMVYGEGPTYRDPLECIE---DSYKH--G--IYDEFVLPSVIVREDGRPVATIQDNDAIIFYNFRPDRAIQISNTFTNEDFREFDRGPK-HPKHLFFVCLTHFSET-V--AGYVAFKPTNLDNTIGEVLSQHGLRQLRIAETEKYPHVTFFMSGGREEEFP--GEDRILINSPK-VPTYDLKPEMSAYEVTDALLKEIE--ADKYDAIILNYANPD-MVGHSG----------------------------------------------------------KLEPTIKAVEAVDECLGKVVDAILA----KGGIAIITADHGNADEVLTPD----------G--K------------PQTAHTTNPVPVIVTKKGIK-------LR-------DGG-------ILGDLAPTMLDLLGLPQPKEMTGKSLIV-
1 PsiBlast_PDB 95.6480% -83 - C4 -1EJJ GPMI_GEOSE A:[3-510] --KKPVALIILDGFALRDETYGNAVAQANKPNFDRYWNEYPH-T-TLKACGEAVGLP-EGQ-MGNSEVGHLNIGAGRIVYQSLTRINIAIREGEFDRNETFLAAMNHVKQHGTSLHLFGLLSDGGVHSHIHHLYALLRLAAKEGVKRVYIHGFLDGRDVGPQTAPQYIKELQ---E---KIKEYG-V---GEIATLSG-RYY-SMDR-D-KRWDRVEKAYRAMVYGEGPTYRDPLECIE---DSYKH--G--IYDEFVLPSVIVREDGRPVATIQDNDAIIFYNFRPDRAIQISNTFTNEDFREFDRGPK-HPKHLFFVCLTHFSET-V--AGYVAFKPTNLDNTIGEVLSQHGLRQLRIAETEKYPHVTFFMSGGREEEFP--GEDRILINSPK-VPTYDLKPEMSAYEVTDALLKEIE--ADKYDAIILNYANPD-MVGHSG----------------------------------------------------------KLEPTIKAVEAVDECLGKVVDAILA----KGGIAIITADHGNADEVLTPD----------G--K------------PQTAHTTNPVPVIVTKKGIK-------LR-------DGG-------ILGDLAPTMLDLLGLPQPKEMTGKSLIV-
4 PsiBlast_PDB 95.5880% -80 - C4 -1O99 GPMI_GEOSE A:[2-511] -SKKPVALIILDGFALRDETYGNAVAQANKPNFDRYWNEYPH-T-TLKACGEAVGLP-EGQ-MGNAEVGHLNIGAGRIVYQSLTRINIAIREGEFDRNETFLAAMNHVKQHGTSLHLFGLLSDGGVHSHIHHLYALLRLAAKEGVKRVYIHGFLDGRDVGPQTAPQYIKELQ---E---KIKEYG-V---GEIATLSG-RYY-SMDR-D-KRWDRVEKAYRAMVYGEGPTYRDPLECIE---DSYKH--G--IYDEFVLPSVIVREDGRPVATIQDNDAIIFYNFRPDRAIQISNTFTNEDFREFDRGPK-HPKHLFFVCLTHFSET-V--AGYVAFKPTNLDNTIGEVLSQHGLRQLRIAETEKYPHVTFFMSGGREEEFP--GEDRILINSPK-VPTYDLKPEMSAYEVTDALLKEIE--ADKYDAIILNYANPD-MVGHSG----------------------------------------------------------KLEPTIKAVEAVDECLGKVVDAILA----KGGIAIITADHGNADEVLTPD----------G--K------------PQTAHTTNPVPVIVTKKGIK-------LR-------DGG-------ILGDLAPTMLDLLGLPQPKEMTGKSLIVK
2 PsiBlast_PDB 95.5080% -81 - C4 -1EQJ GPMI_GEOSE A:[3-510] --KKPVALIILDGFALRDETYGNAVAQANKPNFDRYWNEYPH-T-TLKACGEAVGLP-EGQ-MGNSEVGHLNIGAGRIVYQSLTRINIAIREGEFDRNETFLAAMNHVKQHGTSLHLFGLLSDGGVHSHIHHLYALLRLAAKEGVKRVYIHGFLDGRDVGPQTAPQYIKELQ---E---KIKEYG-V---GEIATLSG-RYY-SMDR-D-KRWDRVEKAYRAMVYGEGPTYRDPLECIE---DSYKH--G--IYDEFVLPSVIVREDGRPVATIQDNDAIIFYNFRPDRAIQISNTFTNEDFREFDRGPK-HPKHLFFVCLTHFSET-V--AGYVAFKPTNLDNTIGEVLSQHGLRQLRIAETEKYPHVTFFMSGGREEEFP--GEDRILINSPK-VPTYDLKPEMSAYEVTDALLKEIE--ADKYDAIILNYANPD-MVGHSG----------------------------------------------------------KLEPTIKAVEAVDECLGKVVDAILA----KGGIAIITADHGNADEVLTPD----------G--K------------PQTAHTTNPVPVIVTKKGIK-------LR-------DGG-------ILGDLAPTMLDLLGLPQPKEMTGKSLIV-
5 PsiBlast_PDB 93.6578% -91 - C4 -2IFY GPMI_BACAN A:[1-508] --RKPTALIILDGFGLREETYGNAVAQAKKPNFDGYWNKFPH-T-TLTACGEAVGLP-EGQ-MGNSEVGHLNIGAGRIVYQSLTRVNVAIREGEFDKNETFQSAIKSVKEKGTALHLFGLLSDGGVHSHMNHMFALLRLAAKEGVEKVYIHAFLDGRDVGPKTAQSYIDATN---E---VIKETG-V---GQFATISG-RYY-SMDR-D-KRWDRVEKCYRAMVNGEGPTYKSAEECVE---DSYAN--G--IYDEFVLPSVIVNEDNTPVATINDDDAVIFYNFRPDRAIQIARVFTNGDFREFDRGEK-VPHIPEFVCMTHFSET-V--DGYVAFKPMNLDNTLGEVVAQAGLKQLRIAETEKYPHVTFFFSGGREAEFP--GEERILINSPK-VATYDLKPEMSIYEVTDALVNEIE--NDKHDVIILNFANCD-MVGHSG----------------------------------------------------------MMEPTIKAVEATDECLGKVVEAILA----KDGVALITADHGNADEELTSE----------G--E------------PMTAHTTNPVPFIVTKNDVE-------LR-------EDG-------ILGDIAPTMLTLLGVEQPKEMTGKTIIK-
23 HHSearch 86.0181% -43 - C4 -1O98 GPMI_GEOSE A:[2-510] -SKKPVALIILDGFALRDETYGNAVAQANKPNFDRYWNEYPH-T-TLKACGEAVGLP-EGQ-MGNSEVGHLNIGAGRIVYQSLTRINIAIREGEFDRNETFLAAMNHVKQHGTSLHLFGLLSDGGVHSHIHHLYALLRLAAKEGVKRVYIHGFLDGRDVGPQTAPQYIKELQ---E---KIKEYG-V---GEIATLSG-RYY-SMDR-D-KRWDRVEKAYRAMVYGEGPTYRDPLECIE---DSYKH--G--IYDEFVLPSVIVREDGRPVATIQDNDAIIFYNFRPDRAIQISNTFTNEDFREFDRG-PKHPKHLFFVCLTHFSET-V--AGYVAFKPTNLDNTIGEVLSQHGLRQLRIAETEKYPHVTFFMSGGREEEFP--GEDRILINSPK-VPTYDLKPEMSAYEVTDALLKEIE--ADKYDAIILNYANPD-MVGHSG----------------------------------------------------------KLEPTIKAVEAVDECLGKVVDAILA----KGGIAIITADHGNADEVLTPD----------G--K------------PQTAHTTNPVPVIVTKKGIK-------LR-------DGG-------ILGDLAPTMLDLLGLPQPKEMTGKSLIV-
22 HHSearch 85.1563% -83 - C4 -4MY4 ? A:[11-513] --KKPTALIILDGFANRESEHGNAVKLANKPNFDRYYNKYPT-T-QIEASGLDVGLP-EGQ-MGNSEVGHMNIGAGRIVYQSLTRINKSIEDGDFFENDVLNNAIAHVNSHDSALHIFGLLSDGGVHSHYKHLFALLELAKKQGVEKVYVHAFLDGRDVDQKSALKYIEETE---A---KFNELG-I---GQFASVSG-RYY-AMDR-D-KRWEREEKAYNAIRNFDAPTYATAKEGVE---ASYNE--G--LTDEFVVPFIVENQND----GVNDGDAVIFYNFRPDRAAQLSEIFANRAFEGFKV--E-QVKDLFYATFTKYNDN-I--DAAIVFEKVDLNNTIGEIAQNNNLTQLRIAETEKYPHVTYFMSGGRNEEFK--GERRRLIDSPK-VATYDLKPEMSAYEVKDALLEELN--KGDLDLIILNFANPD-MVGHSG----------------------------------------------------------MLEPTIKAIEAVDECLGEVVDKILD----MDGYAIITADHGNSDQVLTDD----------D--Q------------PMTTHTTNPVPVIVTKEGVT-------LR-------ETG-------RLGDLAPTLLDLLNVEQPEDMTGESLIKH
8 PsiBlast_PDB 84.5262% -83 - C4 -4NWX ? A:[11-512] --KKPTALIILDGFANRESEHGNAVKLANKPNFDRYYNKYPT-T-QIEASGLDVGLP-EGQ-MGNSEVGHMNIGAGRIVYQSLTRINKSIEDGDFFENDVLNNAIAHVNSHDSALHIFGLLSDGGVHSHYKHLFALLELAKKQGVEKVYVHAFLDGRDVDQKSALKYIEETE---A---KFNELG-I---GQFASVSG-RYY-AMDR-D-KRWEREEKAYNAIRNFDAPTYATAKEGVE---ASYNE--G--LTDEFVVPFIVENQND----GVNDGDAVIFYNFRPDRAAQLSEIFANRAFEGFKVEQ---VKDLFYATFTKYNDN-I--DAAIVFEKVDLNNTIGEIAQNNNLTQLRIAETEKYPHVTYFMSGGRNEEFK--GERRRLIDSPK-VATYDLKPEMSAYEVKDALLEELN--KGDLDLIILNFANPD-MVGHSG----------------------------------------------------------MLEPTIKAIEAVDECLGEVVDKILD----MDGYAIITADHGNSDQVLTDD----------D--Q------------PMTTHTTNPVPVIVTKEGVT-------LR-------ETG-------RLGDLAPTLLDLLNVEQPEDMTGESLIK-
9 PsiBlast_PDB 84.2362% -81 - C4 -4QAX ? A:[11-512] --KKPTALIILDGFANRESEHGNAVKLANKPNFDRYYNKYPT-T-QIEASGLDVGLP-EGQ-MGNSEVGHMNIGAGRIVYQSLTRINKSIEDGDFFENDVLNNAIAHVNSHDSALHIFGLLSDGGVHSHYKHLFALLELAKKQGVEKVYVHAFLDGRDVDQKSALKYIEETE---A---KFNELG-I---GQFASVSG-RYY-AMDR-D-KRWEREEKAYNAIRNFDAPTYATAKEGVE---ASYNE--G--LTDEFVVPFIVENQND----GVNDGDAVIFYNFRPDRAAQLSEIFANRAFEGFKVEQ---VKDLFYATFTKYNDN-I--DAAIVFEKVDLNNTIGEIAQNNNLTQLRIAETEKYPHVTYFMSGGRNEEFK--GERRRLIDSPK-VATYDLKPEMSAYEVKDALLEELN--KGDLDLIILNFANPD-MVGHSG----------------------------------------------------------MLEPTIKAIEAVDECLGEVVDKILD----MDGYAIITADHGNSDQVLTDD----------D--Q------------PMTTHTTNPVPVIVTKEGVT-------LR-------ETG-------RLGDLAPTLLDLLNVEQPEDMTGESLIK-
6 PsiBlast_PDB 84.1062% -82 - C4 -4MY4 ? A:[11-512] --KKPTALIILDGFANRESEHGNAVKLANKPNFDRYYNKYPT-T-QIEASGLDVGLP-EGQ-MGNSEVGHMNIGAGRIVYQSLTRINKSIEDGDFFENDVLNNAIAHVNSHDSALHIFGLLSDGGVHSHYKHLFALLELAKKQGVEKVYVHAFLDGRDVDQKSALKYIEETE---A---KFNELG-I---GQFASVSG-RYY-AMDR-D-KRWEREEKAYNAIRNFDAPTYATAKEGVE---ASYNE--G--LTDEFVVPFIVENQND----GVNDGDAVIFYNFRPDRAAQLSEIFANRAFEGFKVEQ---VKDLFYATFTKYNDN-I--DAAIVFEKVDLNNTIGEIAQNNNLTQLRIAETEKYPHVTYFMSGGRNEEFK--GERRRLIDSPK-VATYDLKPEMSAYEVKDALLEELN--KGDLDLIILNFANPD-MVGHSG----------------------------------------------------------MLEPTIKAIEAVDECLGEVVDKILD----MDGYAIITADHGNSDQVLTDD----------D--Q------------PMTTHTTNPVPVIVTKEGVT-------LR-------ETG-------RLGDLAPTLLDLLNVEQPEDMTGESLIK-
7 PsiBlast_PDB 83.9462% -82 - C4 -4NWJ ? A:[10-512] -AKKPTALIILDGFANRESEHGNAVKLANKPNFDRYYNKYPT-T-QIEASGLDVGLP-EGQ-MGNSEVGHMNIGAGRIVYQSLTRINKSIEDGDFFENDVLNNAIAHVNSHDSALHIFGLLSDGGVHSHYKHLFALLELAKKQGVEKVYVHAFLDGRDVDQKSALKYIEETE---A---KFNELG-I---GQFASVSG-RYY-AMDR-D-KRWEREEKAYNAIRNFDAPTYATAKEGVE---ASYNE--G--LTDEFVVPFIVENQND----GVNDGDAVIFYNFRPDRAAQLSEIFANRAFEGFKVEQ---VKDLFYATFTKYNDN-I--DAAIVFEKVDLNNTIGEIAQNNNLTQLRIAETEKYPHVTYFMSGGRNEEFK--GERRRLIDSPK-VATYDLKPEMSAYEVKDALLEELN--KGDLDLIILNFANPD-MVGHSG----------------------------------------------------------MLEPTIKAIEAVDECLGEVVDKILD----MDGYAIITADHGNSDQVLTDD----------D--Q------------PMTTHTTNPVPVIVTKEGVT-------LR-------ETG-------RLGDLAPTLLDLLNVEQPEDMTGESLIK-
24 HHSearch 55.2532% 36 - C4 -3IGZ ? B:[12-551] LPRRTVLIVVMDGLGIGPEDDYDAVHMASTPFMDAHRRDNRH-FRCVRAHGTAVGLP-TDADMGNSEVGHNALGAGRVALQGASLVDDAIKSGEIYTGEGYRYLHGAFSKEGSTLHLIGLLSDGGVHSRDNQIYSIIEHAVKDGAKRIRVHALYDGRDVPDGSSFRFTDELE---A---VLAKVRQNGCDAAIASGGGRMFV-TMDR-YDADWSIVERGWRAQVLGDARHFHSAKEAIT---TFREEDPK--VTDQYYPPFIVVDEQDKPLGTIEDGDAVLCVNFRGDRVIEMTRAFEDEDFNKFDRV---RVPKVRYAGMMRYDGD-LGIPNNFLVPPPKLTRVSEEYLCGSGLNIFACSETQKFGHVTYFWNGNRSGKIDEKHETFKEVPSDR-V-QFNEKPRMQSAAITEAAIEALK--SGMYNVVRINFPNGD-MVGHTG----------------------------------------------------------DLKATITGVEAVDESLAKLKDAVDS----VNGVYIVTADHGNSDDMAQRDKKGKPMKDGNGNVL------------PLTSHTLSPVPVFIGGAGLDPRVAMRTDL-------PAA-------GLANVTATFINLLGFEAPEDYEPSLIYV-
11 PsiBlast_PDB 54.7331% 36 - C4 -3IGY ? B:[12-543] LPRRTVLIVVMDGLGIGPEDDYDAVHMASTPFMDAHRRDNRHFR-CVRAHGTAVGLPTDAD-MGNSEVGHNALGAGRVALQGASLVDDAIKSGEIYTGEGYRYLHGAFSKEGSTLHLIGLLSDGGVHSRDNQIYSIIEHAVKDGAKRIRVHALYDGRDVPDGSSFRFTDELEAVLA---KVRQNG-CD--AAIASGGG-RMFVTMDRYD-ADWSIVERGWRAQVLGDARHFHSAKEAIT---TFREE--DPKVTDQYYPPFIVVDEQDKPLGTIEDGDAVLCVNFRGDRVIEMTRAFEDEDFNKFDR-VR-VPKVRYAGMMRYDGDLGI--PNNFLVPPPKLTRVSEEYLCGSGLNIFACSETQKFGHVTYFWNGNRSGKID--EKHETFKEVPSDRVQFNEKPRMQSAAITEAAIEALK--SGMYNVVRINFPNGD-MVGHTG----------------------------------------------------------DLKATITGVEAVDESLAKLKDAVDS----VNGVYIVTADHGNSDDMAQRD----------K--KGKPMKDGNGNVLPLTSHTLSPVPVFIGGAGLD-------PRVAMRTDLPAA-------GLANVTATFINLLGFEAPED---------