@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu34620: (2016-07-28 )
MEYAAIHHQPFSTDAYSYDGRTVHIKIRTKKGDADHIRFIWGDPYEYNDGKWSANEQPMRKIAATEMHDYWFAEVVPPFRRLQYAFVVTDDHEDIFFGSSGVCPYNEKTLETIHYYFKFPFVHEADTFQAPEWVKSTVWYQIFPERFANGREDLSPKNALPWGSKDPGVNDFFGGDLQGIVDKLDYLEDLGVNGIYLTPIFSAPSNHKYDTLDYFSIDPHFGDPEIFRTLVSQLHQRGMRIMLDAVFNHIGSASPQWQDVVKNGDQSRYKDWFHIHSFPVTDDNYDRFAFTADMPKLNTANPEVQKYLLDIALYWIREFDIDGWRLDVANEVDHVFWKTFRQAVSTEKPDVYILGEIWHSAEPWLRGDEFHAAMNYPFTEPMIEYFADQTISASRMAHRVNAHLMNGMKQANEVMFNLLDSHDTKRLLTRCRNDEKKARALLAFMFAQTGSPCIYYGTEIGLDGENDPLCRKCMVWEKEKQNQDMLQFMKRLIALRKQENTLLTEGHLEWNLLDDKNDFISFSRTLDEKILIYFFNQGNVVQHISLRELNIDRNNKICDAWTEQPLHYHDVIAVQPGEFLILSAAAPV

Atome Classification :

(35 SA) .........10........20........30........40........50........60........70........80........-90.-.......100.......110.......120.......130.......140.......150.-......160....--...170.......180.......190.......200.....--..210.......220.......230.......240.......250.......260...--....270........280---..---......----290-.......300.......310.......320.......330.......340.......350.......360.......370.......380.......390.......400.......410.......420.......430.......440.......450.......460.......470.......480.......490.......500.......510.......520....-...530.......540.......550.......560...---....570-.........580......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MEYAAIHHQPFSTDAYSYDGRTVHIKIRTKKGDADHIRFIWGDPYEYNDGKWSANEQPMRKIAATEMHDYWFAEVVPPFRRLQYAFVVT-DDH-EDIFFGSSGVCPYNEKTLETIHYYFKFPFVHEADTFQAPEWVKSTVWYQIFPERFANGRED-LSPKNALPWGSKD--PGVNDFFGGDLQGIVDKLDYLEDLGVNGIYLTPIFSAPSNH--KYDTLDYFSIDPHFGDPEIFRTLVSQLHQRGMRIMLDAVFNHIGSASPQWQDVVKNGD--QSRYKD-WFHIHSFPVT----DD---NYDRFA----FTA-DMPKLNTANPEVQKYLLDIALYWIREFDIDGWRLDVANEVDHVFWKTFRQAVSTEKPDVYILGEIWHSAEPWLRGDEFHAAMNYPFTEPMIEYFADQTISASRMAHRVNAHLMNGMKQANEVMFNLLDSHDTKRLLTRCRNDEKKARALLAFMFAQTGSPCIYYGTEIGLDGENDPLCRKCMVWEKEKQNQDMLQFMKRLIALRKQENTLLTEGHLEWNLLDDKNDFISFSRTL-DEKILIYFFNQGNVVQHISLRELNIDRNNKICDAWTEQP---LHYHD---VIAVQPGEFLILSAAAPV
25 PsiBlast_CBE 90.2954% -53 - C1 -1J0J NEPU_GEOSE B:[1-539] MRKEAIYHRPADNFAYAYDSETLHLRLRTKKDDIDRVELLHGDPYDWQNGAWQFQMMPMRKTGSDELFDYWFAEVKPPYRRLRYGFVLY-SGE-EKLVYTEKGF--YFEVPTDDTAYYFCFPFLHRVDLFEAPDWVKDTVWYQIFPERFANGNPS-ISPEGSRPWGSED--PTPTSFFGGDLQGIIDHLDYLVDLGITGIYLTPIFRSPSNH--KYDTADYFEVDPHFGDKETLKTLIDRCHEKGIRVMLDAVFNHCGYEFAPFQDVWKNGE--SSKYKD-WFHIHEFPLQ----TEPRPNYDTFA----FVP-QMPKLNTANPEVKRYLLDVATYWIREFDIDGWRLDVANEIDHEFWREFRQEVKALKPDVYILGQIWHDAMPWLRGDQFDAVMNYPFTDGVLRFFAKEEISARQFANQMMHVLHSYPNNVNEAAFNLLGSHDTSRILTVCGGDIRKVKLLFLFQLTFTGSPCIYYGDEIGMTGGNDPECRKCMVWDPMQQNKELHQHVKQLIALRKQYRS-LRRGEISFLHADDEMNYLIYKKTD-GDETVLVIINRSD-------------------------------------------------------
61 HHSearch 89.6351% -48 - C1 -1J0H NEPU_GEOSE A:[1-587] MRKEAIYHRPADNFAYAYDSETLHLRLRTKKDDIDRVELLHGDPYDWQNGAWQFQMMPMRKTGSDELFDYWFAEVKPPYRRLRYGFVLY-SGE-EKLVYTEKGFYFEVPT--DDTAYYFCFPFLHRVDLFEAPDWVKDTVWYQIFPERFANGNPS-ISPEGSRPWGSED--PTPTSFFGGDLQGIIDHLDYLVDLGITGIYLTPIFRSPSNH--KYDTADYFEVDPHFGDKETLKTLIDRCHEKGIRVMLDAVFNHCGYEFAPFQDVWKNGE--SSKYKD-WFHIHEFPLQTEP-RP---NYDTFA----FVP-QMPKLNTANPEVKRYLLDVATYWIREFDIDGWRLDVANEIDHEFWREFRQEVKALKPDVYILGEIWHDAMPWLRGDQFDAVMNYPFTDGVLRFFAKEEISARQFANQMMHVLHSYPNNVNEAAFNLLGSHDTSRILTVCGGDIRKVKLLFLFQLTFTGSPCIYYGDEIGMTGGNDPECRKCMVWDPMQQNKELHQHVKQLIALRKQYRSLR-RGEISFLHADDEMNYLIYKKTD-GDETVLVIINRSDQKADIPIPLDARGT--WLVNLLTGERFAAEAETL---CTSLPPYGFVLYAIEH--
3 PsiBlast_PDB 88.8854% -53 - C1 -1J0H NEPU_GEOSE A:[1-539] MRKEAIYHRPADNFAYAYDSETLHLRLRTKKDDIDRVELLHGDPYDWQNGAWQFQMMPMRKTGSDELFDYWFAEVKPPYRRLRYGFVLY-SGE-EKLVYTEKGF--YFEVPTDDTAYYFCFPFLHRVDLFEAPDWVKDTVWYQIFPERFANGNPS-ISPEGSRPWGSED--PTPTSFFGGDLQGIIDHLDYLVDLGITGIYLTPIFRSPSNH--KYDTADYFEVDPHFGDKETLKTLIDRCHEKGIRVMLDAVFNHCGYEFAPFQDVWKNGE--SSKYKD-WFHIHEFPLQ----TEPRPNYDTFA----FVP-QMPKLNTANPEVKRYLLDVATYWIREFDIDGWRLDVANEIDHEFWREFRQEVKALKPDVYILGEIWHDAMPWLRGDQFDAVMNYPFTDGVLRFFAKEEISARQFANQMMHVLHSYPNNVNEAAFNLLGSHDTSRILTVCGGDIRKVKLLFLFQLTFTGSPCIYYGDEIGMTGGNDPECRKCMVWDPMQQNKELHQHVKQLIALRKQYRS-LRRGEISFLHADDEMNYLIYKKTD-GDETVLVIINRSD-------------------------------------------------------
24 PsiBlast_CBE 87.9154% -51 - C1 -1J0K NEPU_GEOSE B:[1-539] MRKEAIYHRPADNFAYAYDSETLHLRLRTKKDDIDRVELLHGDPYDWQNGAWQFQMMPMRKTGSDELFDYWFAEVKPPYRRLRYGFVLY-SGE-EKLVYTEKGF--YFEVPTDDTAYYFCFPFLHRVDLFEAPDWVKDTVWYQIFPERFANGNPS-ISPEGSRPWGSED--PTPTSFFGGDLQGIIDHLDYLVDLGITGIYLTPIFRSPSNH--KYDTADYFEVDPHFGDKETLKTLIDRCHEKGIRVMLDAVFNHCGYEFAPFQDVWKNGE--SSKYKD-WFHIHEFPLQ----TEPRPNYDTFA----FVP-QMPKLNTANPEVKRYLLDVATYWIREFDIDGWRLDVANEIDHEFWREFRQEVKALKPDVYILGQIWHDAMPWLRGDQFDAVMNYPFTDGVLRFFAKEEISARQFANQMMHVLHSYPNNVNEAAFNLLGSHDTSRILTVCGGDIRKVKLLFLFQLTFTGSPCIYYGDEIGMTGGNDPECRKCMVWDPMQQNKELHQHVKQLIALRKQYRS-LRRGEISFLHADDEMNYLIYKKTD-GDETVLVIINRSD-------------------------------------------------------
6 PsiBlast_PDB 87.3254% -55 - C1 -1J0K NEPU_GEOSE A:[1-539] MRKEAIYHRPADNFAYAYDSETLHLRLRTKKDDIDRVELLHGDPYDWQNGAWQFQMMPMRKTGSDELFDYWFAEVKPPYRRLRYGFVLY-SGE-EKLVYTEKGF--YFEVPTDDTAYYFCFPFLHRVDLFEAPDWVKDTVWYQIFPERFANGNPS-ISPEGSRPWGSED--PTPTSFFGGDLQGIIDHLDYLVDLGITGIYLTPIFRSPSNH--KYDTADYFEVDPHFGDKETLKTLIDRCHEKGIRVMLDAVFNHCGYEFAPFQDVWKNGE--SSKYKD-WFHIHEFPLQ----TEPRPNYDTFA----FVP-QMPKLNTANPEVKRYLLDVATYWIREFDIDGWRLDVANEIDHEFWREFRQEVKALKPDVYILGQIWHDAMPWLRGDQFDAVMNYPFTDGVLRFFAKEEISARQFANQMMHVLHSYPNNVNEAAFNLLGSHDTSRILTVCGGDIRKVKLLFLFQLTFTGSPCIYYGDEIGMTGGNDPECRKCMVWDPMQQNKELHQHVKQLIALRKQYRS-LRRGEISFLHADDEMNYLIYKKTD-GDETVLVIINRSD-------------------------------------------------------
4 PsiBlast_PDB 87.2554% -51 - C1 -1J0I NEPU_GEOSE A:[1-539] MRKEAIYHRPADNFAYAYDSETLHLRLRTKKDDIDRVELLHGDPYDWQNGAWQFQMMPMRKTGSDELFDYWFAEVKPPYRRLRYGFVLY-SGE-EKLVYTEKGF--YFEVPTDDTAYYFCFPFLHRVDLFEAPDWVKDTVWYQIFPERFANGNPS-ISPEGSRPWGSED--PTPTSFFGGDLQGIIDHLDYLVDLGITGIYLTPIFRSPSNH--KYDTADYFEVDPHFGDKETLKTLIDRCHEKGIRVMLDAVFNHCGYEFAPFQDVWKNGE--SSKYKD-WFHIHEFPLQ----TEPRPNYDTFA----FVP-QMPKLNTANPEVKRYLLDVATYWIREFDIDGWRLDVANEIDHEFWREFRQEVKALKPDVYILGEIWHDAMPWLRGDQFDAVMNYPFTDGVLRFFAKEEISARQFANQMMHVLHSYPNNVNEAAFNLLGSHDTSRILTVCGGDIRKVKLLFLFQLTFTGSPCIYYGDEIGMTGGNDPECRKCMVWDPMQQNKELHQHVKQLIALRKQYRS-LRRGEISFLHADDEMNYLIYKKTD-GDETVLVIINRSD-------------------------------------------------------
5 PsiBlast_PDB 86.9554% -53 - C1 -1J0J NEPU_GEOSE A:[1-539] MRKEAIYHRPADNFAYAYDSETLHLRLRTKKDDIDRVELLHGDPYDWQNGAWQFQMMPMRKTGSDELFDYWFAEVKPPYRRLRYGFVLY-SGE-EKLVYTEKGF--YFEVPTDDTAYYFCFPFLHRVDLFEAPDWVKDTVWYQIFPERFANGNPS-ISPEGSRPWGSED--PTPTSFFGGDLQGIIDHLDYLVDLGITGIYLTPIFRSPSNH--KYDTADYFEVDPHFGDKETLKTLIDRCHEKGIRVMLDAVFNHCGYEFAPFQDVWKNGE--SSKYKD-WFHIHEFPLQ----TEPRPNYDTFA----FVP-QMPKLNTANPEVKRYLLDVATYWIREFDIDGWRLDVANEIDHEFWREFRQEVKALKPDVYILGQIWHDAMPWLRGDQFDAVMNYPFTDGVLRFFAKEEISARQFANQMMHVLHSYPNNVNEAAFNLLGSHDTSRILTVCGGDIRKVKLLFLFQLTFTGSPCIYYGDEIGMTGGNDPECRKCMVWDPMQQNKELHQHVKQLIALRKQYRS-LRRGEISFLHADDEMNYLIYKKTD-GDETVLVIINRSD-------------------------------------------------------
22 PsiBlast_CBE 86.6854% -50 - C1 -1J0I NEPU_GEOSE B:[1-539] MRKEAIYHRPADNFAYAYDSETLHLRLRTKKDDIDRVELLHGDPYDWQNGAWQFQMMPMRKTGSDELFDYWFAEVKPPYRRLRYGFVLY-SGE-EKLVYTEKGF--YFEVPTDDTAYYFCFPFLHRVDLFEAPDWVKDTVWYQIFPERFANGNPS-ISPEGSRPWGSED--PTPTSFFGGDLQGIIDHLDYLVDLGITGIYLTPIFRSPSNH--KYDTADYFEVDPHFGDKETLKTLIDRCHEKGIRVMLDAVFNHCGYEFAPFQDVWKNGE--SSKYKD-WFHIHEFPLQ----TEPRPNYDTFA----FVP-QMPKLNTANPEVKRYLLDVATYWIREFDIDGWRLDVANEIDHEFWREFRQEVKALKPDVYILGEIWHDAMPWLRGDQFDAVMNYPFTDGVLRFFAKEEISARQFANQMMHVLHSYPNNVNEAAFNLLGSHDTSRILTVCGGDIRKVKLLFLFQLTFTGSPCIYYGDEIGMTGGNDPECRKCMVWDPMQQNKELHQHVKQLIALRKQYRS-LRRGEISFLHADDEMNYLIYKKTD-GDETVLVIINRSD-------------------------------------------------------
23 PsiBlast_CBE 84.9254% -48 - C1 -1J0H NEPU_GEOSE B:[1-539] MRKEAIYHRPADNFAYAYDSETLHLRLRTKKDDIDRVELLHGDPYDWQNGAWQFQMMPMRKTGSDELFDYWFAEVKPPYRRLRYGFVLY-SGE-EKLVYTEKGF--YFEVPTDDTAYYFCFPFLHRVDLFEAPDWVKDTVWYQIFPERFANGNPS-ISPEGSRPWGSED--PTPTSFFGGDLQGIIDHLDYLVDLGITGIYLTPIFRSPSNH--KYDTADYFEVDPHFGDKETLKTLIDRCHEKGIRVMLDAVFNHCGYEFAPFQDVWKNGE--SSKYKD-WFHIHEFPLQ----TEPRPNYDTFA----FVP-QMPKLNTANPEVKRYLLDVATYWIREFDIDGWRLDVANEIDHEFWREFRQEVKALKPDVYILGEIWHDAMPWLRGDQFDAVMNYPFTDGVLRFFAKEEISARQFANQMMHVLHSYPNNVNEAAFNLLGSHDTSRILTVCGGDIRKVKLLFLFQLTFTGSPCIYYGDEIGMTGGNDPECRKCMVWDPMQQNKELHQHVKQLIALRKQYRS-LRRGEISFLHADDEMNYLIYKKTD-GDETVLVIINRSD-------------------------------------------------------
21 PsiBlast_CBE 84.7455% -53 - C1 -1GVI ? B:[1-546] MRKEAIHHRSTDNFAYAYDSETLHLRLQTKKNDVDHVELLFGDPYEWHDGAWQFQTMPMRKTGSDGLFDYWLAEVKPPYRRLRYGFVLR-AGG-EKLVYTEKGF--YHEAPSDDTAYYFCFPFLHRVDLFQAPDWVKDTVWYQIFPERFANGNPA-ISPKGARPWGSED--PTPTSFFGGDLQGIIDHLDYLADLGITGIYLTPIFRAPSNH--KYDTADYFEIDPHFGDKETLKTLVKRCHEKGIRVMLDAVFNHCGYEFAPFQDVLKNGA--ASRYKD-WFHIREFPLQ----TEPRPNYDTFA----FVP-HMPKLNTAHPEVKRYLLDVATYWIREFDIDGWRLDVANEIDHQFWREFRQAVKALKPDVYILGLIWHDAMPWLRGDQFDAVMNYPLADAALRFFAKEDMSASEFADRLMHVLHSYPKQVNEAAFNLLGSHDTPRLLTVCGGDVRKVKLLFLFQLTFTGSPCIYYGDEIGMTGGNDPECRKCMVWDPEKQNKELYEHVKQLIALRKQYRA-LRRGDVAFLTADDEVNHLVYAKTD-GNETVMIIINRSNEAAEIPM------------------------------------------------
2 PsiBlast_PDB 84.6855% -52 - C1 -1GVI ? A:[1-546] MRKEAIHHRSTDNFAYAYDSETLHLRLQTKKNDVDHVELLFGDPYEWHDGAWQFQTMPMRKTGSDGLFDYWLAEVKPPYRRLRYGFVLR-AGG-EKLVYTEKGF--YHEAPSDDTAYYFCFPFLHRVDLFQAPDWVKDTVWYQIFPERFANGNPA-ISPKGARPWGSED--PTPTSFFGGDLQGIIDHLDYLADLGITGIYLTPIFRAPSNH--KYDTADYFEIDPHFGDKETLKTLVKRCHEKGIRVMLDAVFNHCGYEFAPFQDVLKNGA--ASRYKD-WFHIREFPLQ----TEPRPNYDTFA----FVP-HMPKLNTAHPEVKRYLLDVATYWIREFDIDGWRLDVANEIDHQFWREFRQAVKALKPDVYILGLIWHDAMPWLRGDQFDAVMNYPLADAALRFFAKEDMSASEFADRLMHVLHSYPKQVNEAAFNLLGSHDTPRLLTVCGGDVRKVKLLFLFQLTFTGSPCIYYGDEIGMTGGNDPECRKCMVWDPEKQNKELYEHVKQLIALRKQYRA-LRRGDVAFLTADDEVNHLVYAKTD-GNETVMIIINRSNEAAEIPM------------------------------------------------
1 PsiBlast_PDB 81.5456% -50 - C1 -1SMA - ? A:[1-546] MRKEAIHHRSTDNFAYAYDSETLHLRLQTKKNDVDHVELLFGDPYEWHDGAWQFQTMPMRKTGSDGLFDYWLAEVKPPYRRLRYGFVLR-AGG-EKLVYTEKGF--YHEAPSDDTAYYFCFPFLHRVDLFQAPDWVKDTVWYQIFPERFANGNPA-ISPKGARPWGSED--PTPTSFFGGDLQGIIDHLDYLADLGITGIYLTPIFRAPSNH--KYDTADYFEIDPHFGDKETLKTLVKRCHEKGIRVMLDAVFNHCGYEFAPFQDVLKNGA--ASRYKD-WFHIREFPLQ----TEPRPNYDTFA----FVP-HMPKLNTAHPEVKRYLLDVATYWIREFDIDGWRLDVANEIDHQFWREFRQAVKALKPDVYILGEIWHDAMPWLRGDQFDAVMNYPLADAALRFFAKEDMSASEFADRLMHVLHSYPKQVNEAAFNLLGSHDTPRLLTVCGGDVRKVKLLFLFQLTFTGSPCIYYGDEIGMTGGNDPECRKCMVWDPEKQNKELYEHVKQLIALRKQYRA-LRRGDVAFLTADDEVNHLVYAKTD-GNETVMIIINRSNEAAEIPM------------------------------------------------
50 Fugue 75.8052% 8 * C1 *1SMA - ? A:[1-588] MRKEAIHHRSTDNFAYAYDSETLHLRLQTKKNDVDHVELLFGDPYEWHDGAWQFQTMPMRKTGSDGLFDYWLAEVKPPYRRLRYGFVLRA-GG-EKLVYTEKG--FYHEAPSDDTAYYFCFPFLHRVDLFQAPDWVKDTVWYQIFPERFANGNP-AISPKGARPWGSED--PTPTSFFGGDLQGIIDHLDYLADLGITGIYLTPIFRAPSNH--KYDTADYFEIDPHFGDKETLKTLVKRCHEKGIRVMLDAVFNHCGYEFAPFQDVLKNGA--ASRYKD-WFHIREFPLQ----TE---PRPNYDTFAF-VP-HMPKLNTAHPEVKRYLLDVATYWIREFDIDGWRLDVANEIDHQFWREFRQAVKALKPDVYILGEIWHDAMPWLRGDQFDAVMNYPLADAALRFFAKEDMSASEFADRLMHVLHSYPKQVNEAAFNLLGSHDTPRLLTVCGGDVRKVKLLFLFQLTFTGSPCIYYGDEIGMTGGNDPECRKCMVWDPEKQNKELYEHVKQLIALRKQ-YRALRRGDVAFLTADDEVNHLVYAKTD-GNETVMIIINRSNEAAEIPMPI-DA-RGKWLVNLLTGER---FAAEAETLCVSLPPYGFVLYAVESW-
10 PsiBlast_PDB 75.0342% -3 - C1 -3A6O NEPU2_THEVU A:[1-536] MLLEAIFHEAKGSYAYPISETQLRVRLRAKKGDVVRCEVLYADRYASPEEELA--HALAGKAGSDERFDYFEALLECSTKRVKYVFLLT-GPQGEAVYFGETGFSAERSKA-----GVFQYAYIHRSEVFTTPEWAKEAVIYQIFPERFANGDPS-NDPPGTEQW-AKDARPRHDSFYGGDLKGVIDRLPYLEELGVTALYFTPIFASPSHH--KYDTADYLAIDPQFGDLPTFRRLVDEAHRRGIKIILDAVFNHAGDQFFAFRDVLQKGE--QSRYKD-WFFIEDFPVS----KTSRTNYETFA----VQVPAMPKLRTENPEVKEYLFDVARFWM-EQGIDGWRLDVANEVDHAFWREFRRLVKSLNPDALIVGEIWHDASGWLMGDQFDSVMNYLFRESVIRFFATGEIHAERFDAELTRARMLYPEQAAQGLWNLLDSHDTERFLTSCGGNEAKFRLAVLFQMTYLGTPLIYYGDEIGMAGATDPDCRRPMIWEEKEQNRGLFEFYKELIRLRHRLAS-LTRGNVRSWHADKQANLYAFVRTVQDQHVGVVLNNRG--------------------------------------------------------
8 PsiBlast_PDB 74.9042% -4 - C1 -1BVZ - NEPU2_THEVU A:[1-536] MLLEAIFHEAKGSYAYPISETQLRVRLRAKKGDVVRCEVLYADRYASPEEELA--HALAGKAGSDERFDYFEALLECSTKRVKYVFLLT-GPQGEAVYFGETGFSAERSKA-----GVFQYAYIHRSEVFTTPEWAKEAVIYQIFPERFANGDPS-NDPPGTEQW-AKDARPRHDSFYGGDLKGVIDRLPYLEELGVTALYFTPIFASPSHH--KYDTADYLAIDPQFGDLPTFRRLVDEAHRRGIKIILDAVFNHAGDQFFAFRDVLQKGE--QSRYKD-WFFIEDFPVS----KTSRTNYETFA----VQVPAMPKLRTENPEVKEYLFDVARFWM-EQGIDGWRLDVANEVDHAFWREFRRLVKSLNPDALIVGEIWHDASGWLMGDQFDSVMNYLFRESVIRFFATGEIHAERFDAELTRARMLYPEQAAQGLWNLLDSHDTERFLTSCGGNEAKFRLAVLFQMTYLGTPLIYYGDEIGMAGATDPDCRRPMIWEEKEQNRGLFEFYKELIRLRHRLAS-LTRGNVRSWHADKQANLYAFVRTVQDQHVGVVLNNRG--------------------------------------------------------
18 PsiBlast_PDB 74.8442% -5 - C1 -1G1Y NEPU2_THEVU A:[1-536] MLLEAIFHEAKGSYAYPISETQLRVRLRAKKGDVVRCEVLYADRYASPEEELA--HALAGKAGSDERFDYFEALLECSTKRVKYVFLLT-GPQGEAVYFGETGFSAERSKA-----GVFQYAYIHRSEVFTTPEWAKEAVIYQIFPERFANGDPS-NDPPGTEQW-AKDARPRHDSFYGGDLKGVIDRLPYLEELGVTALYFTPIFASPSHH--KYDTADYLAIDPQFGDLPTFRRLVDEAHRRGIKIILDAVFNHAGDQFFAFRDVLQKGE--QSRYKD-WFFIEDFPVS----KTSRTNYETFA----VQVPAMPKLRTENPEVKEYLFDVARFWM-EQGIDGWRLDVANEVDHAFWREFRRLVKSLNPDALIVGAIWHDASGWLMGDQFDSVMNYLFRESVIRFFATGEIHAERFDAELTRARMLYPEQAAQGLWNLLDSHDTERFLTSCGGNEAKFRLAVLFQMTYLGTPLIYYGDEIGMAGATDPDCRRPMIWEEKEQNRGLFEFYKELIRLRHRLAS-LTRGNVRSWHADKQANLYAFVRTVQDQHVGVVLNNRG--------------------------------------------------------
60 HHSearch 74.6645% -39 - C1 -1EA9 - ? C:[1-582] MFLEAVYHRPRKNFSYAYNGTTVHLRIRTKKDDMTAVYALAGDKYMWDHT---MEYVPMTKLATDELFDYWECEVTPPYRRVKYGFLLQ-QGH-EKRWMTEYDFLTEPP---ANPDRLFEYPFINPVDVFQPPAWVKDAIFYQIFPERFANGDTR-NDPEGTLPWGSAD--PTPSCFFGGDLQGVIDHLDHLSKLGVNAVYFTPLFKATTNH--KYDTEDYFQIDPQFGDKDTLKKLVDLCHERGIRVLLDAVFNHSGRTFPPFVDVLKNGE--KSKYKD-WFHIRSLPLEVVDGIP---TYDTFA----FEP-LMPKLNTEHPDVKEYLLKAAEYWIRETGIDGWRLDVANEVSHQFWREFRRVVKQANPDAYILGEVWHESSIWLEGDQFDAVMNYPFTNAVLDFFIHQIADAEKFSFMLGKQLAGYPRQASEVMFNLLDSHDTARLLTQADGDKRKMKLAVLFQFTYFGTPCIYYGDEVGLDGGHDPGCRKCMEWDETKHDKDLFAFYQTVIRLRQAHAALR-TGTFKFLTAEKNSRQIAYLRED-DQDTILVVMNNDKAGHTLTLPVRH-A---QWTHLWQDDVLTAAHGQL---TVKLPAYGFAVLKASS--
30 PsiBlast_CBE 74.5842% -3 - C1 -2D2O NEPU2_THEVU B:[1-536] MLLEAIFHEAKGSYAYPISETQLRVRLRAKKGDVVRCEVLYADRYASPEEELA--HALAGKAGSDERFDYFEALLECSTKRVKYVFLLT-GPQGEAVYFGETGFSAERSKA-----GVFQYAYIHRSEVFTTPEWAKEAVIYQIFPERFANGDPS-NDPPGTEQW-AKDARPRHDSFYGGDLKGVIDRLPYLEELGVTALYFTPIFASPSHH--KYDTADYLAIDPQFGDLPTFRRLVDEAHRRGIKIILDAVFNHAGDQFFAFRDVLQKGE--QSRYKD-WFFIEDFPVS----KTSRTNYETFA----VQVPAMPKLRTENPEVKEYLFDVARFWM-EQGIDGWRLNVANEVDHAFWREFRRLVKSLNPDALIVGEIWHDASGWLMGDQFDSVMNYLFRESVIRFFATGEIHAERFDAELTRARMLYPEQAAQGLWNLLDSHDTERFLTSCGGNEAKFRLAVLFQMTYLGTPLIYYGDEIGMAGATDPDCRRPMIWEEKEQNRGLFEFYKELIRLRHRLAS-LTRGNVRSWHADKQANLYAFVRTVQDQHVGVVLNNRG--------------------------------------------------------
27 PsiBlast_CBE 74.0542% -3 - C1 -1JI2 NEPU2_THEVU B:[1-536] MLLEAIFHEAKGSYAYPISETQLRVRLRAKKGDVVRCEVLYADRYASPEEELA--HALAGKAGSDERFDYFEALLECSTKRVKYVFLLT-GPQGEAVYFGETGFSAERSKA-----GVFQYAYIHRSEVFTTPEWAKEAVIYQIFPERFANGDPS-NDPPGTEQW-AKDARPRHDSFYGGDLKGVIDRLPYLEELGVTALYFTPIFASPSHH--KYDTADYLAIDPQFGDLPTFRRLVDEAHRRGIKIILDAVFNHAGDQFFAFRDVLQKGE--QSRYKD-WFFIEDFPVS----KTSRTNYETFA----VQVPAMPKLRTENPEVKEYLFDVARFWM-EQGIDGWRLDVANEVDHAFWREFRRLVKSLNPDALIVGEIWHDASGWLMGDQFDSVMNYLFRESVIRFFATGEIHAERFDAELTRARMLYPEQAAQGLWNLLDSHDTERFLTSCGGNEAKFRLAVLFQMTYLGTPLIYYGDEIGMAGATDPDCRRPMIWEEKEQNRGLFEFYKELIRLRHRLAS-LTRGNVRSWHADKQANLYAFVRTVQDQHVGVVLNNRG--------------------------------------------------------
33 PsiBlast_CBE 73.6442% -3 - C1 -1JL8 NEPU2_THEVU B:[1-536] MLLEAIFHEAKGSYAYPISETQLRVRLRAKKGDVVRCEVLYADRYASPEEELA--HALAGKAGSDERFDYFEALLECSTKRVKYVFLLT-GPQGEAVYFGETGFSAERSKA-----GVFQYAYIHRSEVFTTPEWAKEAVIYQIFPERFANGDPS-NDPPGTEQW-AKDARPRHDSFYGGDLKGVIDRLPYLEELGVTALYFTPIFASPSHH--KYDTADYLAIDPQFGDLPTFRRLVDEAHRRGIKIILDAVFNHAGDQFFAFRDVLQKGE--QSRYKD-WFFIEDFPVS----KTSRTNYETFA----VQVPAMPKLRTENPEVKEYLFDVARFWM-EQGIDGWRLNVANEVDHAFWREFRRLVKSLNPDALIVGEIWHDASGWLMGDQFDSVMNYLFRESVIRFFATGEIHAERFDAELTRARMLYPEQAAQGLWNLLDSHDTERFLTSCGGNEAKFRLAVLFQMTYLGTPLIYYGDEIGMAGATDPDCRRPMIWEEKEQNRGLFEFYKELIRLRHRLAS-LTRGNVRSWHADKQANLYAFVRTVQDQHVGVVLNNRG--------------------------------------------------------
15 PsiBlast_PDB 73.0642% -2 - C1 -1VB9 NEPU2_THEVU A:[1-536] MLLEAIFHEAKGSYAYPISETQLRVRLRAKKGDVVRCEVLYADRYASPEEELA--HALAGKAGSDERFDYFEALLECSTKRVKYVFLLT-GPQGEAVYFGETGFSAERSKA-----GVFQYAYIHRSEVFTTPEWAKEAVIYQIFPERFANGDPS-NDPPGTEQW-AKDARPRHDSFYGGDLKGVIDRLPYLEELGVTALYFTPIFASPSHH--KYDTADYLAIDPQFGDLPTFRRLVDEAHRRGIKIILDAVFNHAGDQFFAFRDVLQKGE--QSRYKD-WFFIEDFPVS----KTSRTNYETFA----VQVPAMPKLRTENPEVKEYLFDVARFWM-EQGIDGWRLNVANEVDHAFWREFRRLVKSLNPDALIVGEIWHDASGWLMGDQFDSVMNYLFRESVIRFFATGEIHAERFDAELTRARMLYPEQAAQGLWNLLDSHDTERFLTSCGGNEAKFRLAVLFQMTYLGTPLIYYGDEIGMAGATDPDCRRPMIWEEKEQNRGLFEFYKELIRLRHRLAS-LTRGNVRSWHADKQANLYAFVRTVQDQHVGVVLNNRG--------------------------------------------------------
13 PsiBlast_PDB 72.9542% -6 - C1 -1JL8 NEPU2_THEVU A:[1-536] MLLEAIFHEAKGSYAYPISETQLRVRLRAKKGDVVRCEVLYADRYASPEEELA--HALAGKAGSDERFDYFEALLECSTKRVKYVFLLT-GPQGEAVYFGETGFSAERSKA-----GVFQYAYIHRSEVFTTPEWAKEAVIYQIFPERFANGDPS-NDPPGTEQW-AKDARPRHDSFYGGDLKGVIDRLPYLEELGVTALYFTPIFASPSHH--KYDTADYLAIDPQFGDLPTFRRLVDEAHRRGIKIILDAVFNHAGDQFFAFRDVLQKGE--QSRYKD-WFFIEDFPVS----KTSRTNYETFA----VQVPAMPKLRTENPEVKEYLFDVARFWM-EQGIDGWRLNVANEVDHAFWREFRRLVKSLNPDALIVGEIWHDASGWLMGDQFDSVMNYLFRESVIRFFATGEIHAERFDAELTRARMLYPEQAAQGLWNLLDSHDTERFLTSCGGNEAKFRLAVLFQMTYLGTPLIYYGDEIGMAGATDPDCRRPMIWEEKEQNRGLFEFYKELIRLRHRLAS-LTRGNVRSWHADKQANLYAFVRTVQDQHVGVVLNNRG--------------------------------------------------------
32 PsiBlast_CBE 72.7942% -4 - C1 -1VB9 NEPU2_THEVU B:[1-536] MLLEAIFHEAKGSYAYPISETQLRVRLRAKKGDVVRCEVLYADRYASPEEELA--HALAGKAGSDERFDYFEALLECSTKRVKYVFLLT-GPQGEAVYFGETGFSAERSKA-----GVFQYAYIHRSEVFTTPEWAKEAVIYQIFPERFANGDPS-NDPPGTEQW-AKDARPRHDSFYGGDLKGVIDRLPYLEELGVTALYFTPIFASPSHH--KYDTADYLAIDPQFGDLPTFRRLVDEAHRRGIKIILDAVFNHAGDQFFAFRDVLQKGE--QSRYKD-WFFIEDFPVS----KTSRTNYETFA----VQVPAMPKLRTENPEVKEYLFDVARFWM-EQGIDGWRLNVANEVDHAFWREFRRLVKSLNPDALIVGEIWHDASGWLMGDQFDSVMNYLFRESVIRFFATGEIHAERFDAELTRARMLYPEQAAQGLWNLLDSHDTERFLTSCGGNEAKFRLAVLFQMTYLGTPLIYYGDEIGMAGATDPDCRRPMIWEEKEQNRGLFEFYKELIRLRHRLAS-LTRGNVRSWHADKQANLYAFVRTVQDQHVGVVLNNRG--------------------------------------------------------
40 PsiBlast_CBE 72.5342% -6 - C1 -1VFO NEPU2_THEVU B:[1-536] MLLEAIFHEAKGSYAYPISETQLRVRLRAKKGDVVRCEVLYADRYASPEEELA--HALAGKAGSDERFDYFEALLECSTKRVKYVFLLT-GPQGEAVYFGETGFSAERSKA-----GVFQYAYIHRSEVFTTPEWAKEAVIYQIFPERFANGDPS-NDPPGTEQW-AKDARPRHDSFYGGDLKGVIDRLPYLEELGVTALYFTPIFASPSHH--KYDTADYLAIDPQFGDLPTFRRLVDEAHRRGIKIILDAVFNHAGDQFFAFRDVLQKGE--QSRYKD-WFFIEDFPVS----KTSRTNYETFA----VQVPAMPKLRTENPEVKEYLFDVARFWM-EQGIDGWRLNVANEVDHAFWREFRRLVKSLNPDALIVGEIWHDASGWLMGDQFDSVMNYLFRESVIRFFATGEIHAERFDAELTRARMLYPEQAAQGLWNLLDSHNTERFLTSCGGNEAKFRLAVLFQMTYLGTPLIYYGDEIGMAGATDPDCRRPMIWEEKEQNRGLFEFYKELIRLRHRLAS-LTRGNVRSWHADKQANLYAFVRTVQDQHVGVVLNNRG--------------------------------------------------------