@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu35580: (2016-07-30 )
MKKIAVIGTGYVGLVSGTCFAEIGNKVVCCDIDESKIRSLKNGVIPIYEPGLADLVEKNVLDQRLTFTNDIPSAIRASDIIYIAVGTPMSKTGEADLTYVKAAAKTIGEHLNGYKVIVNKSTVPVGTGKLVQSIVQKASKGRYSFDVVSNPEFLREGSAIHDTMNMERAVIGSTSHKAAAIIEELHQPFHAPVIKTNLESAEMIKYAANAFLATKISFINDIANICERVGADVSKVADGVGLDSRIGRKFLKAGIGFGGSCFPKDTTALLQIAKSAGYPFKLIEAVIETNEKQRVHIVDKLLTVMGSVKGRTISVLGLAFKPNTNDVRSAPALDIIPMLQQLGAHVKAYDPIAIPEASAILGEQVEYYTDVYAAMEDTDACLILTDWPEVKEMELVKVKTLLKQPVIIDGRNLFSLEEMQAAGYIYHSIGRPAVRGTEPSDKYFPGLPLEELAKDLGSVNL

Atome Classification :

(22 SA) .........10........20....--....30........40........50........60........70........80.......-----.90.-........100.......110---.......120.......130.....---..140-..---.......150.......160.......170...----.----...180.......---190--.---.......200.......210.......220.......230.......240.......250.......260.......270.......--280.......290.......300-.-..-.-...310.......320.......330.......340.......350.......360----------.---------.----------.......----370.......380.......390......-.400.......410...--....420.......430.......440.......450.......460
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MKKIAVIGTGYVGLVSGTCFAEIGN--KVVCCDIDESKIRSLKNGVIPIYEPGLADLVEKNVLDQRLTFTNDIPSAIRASDIIYIAVGTP-----MS-K-TGEADLTYVKAAAKTIGEHLN---GYKVIVNKSTVPVGTGKLVQSIVQK---ASK---GR---YSFDVVSNPEFLREGSAIHDTMNMERAVIGSTS----H----KAAAIIEELHQPF---HA---P---VIKTNLESAEMIKYAANAFLATKISFINDIANICERVGADVSKVADGVGLDSRIGRKFLKAGIGFGGSCFPKDTTALLQIAKSAGYP--FKLIEAVIETNEKQRVHIVDKLL-T-VM-G-SVKGRTISVLGLAFKPNTNDVRSAPALDIIPMLQQLGAHVKAYDPIAIPEASAI------------L---------G----------EQVEYYT----DVYAAMEDTDACLILTDWPEVKEMELVKV-KTLLKQPVIIDGRNLFS--LEEMQAAGYIYHSIGRPAVRGTEPSDKYFPGLPLEELAKDLGSVNL
2 PsiBlast_PDB 97.0048% 0 - C- -3GG2 ? A:[5-428] ---IAVVGIGYVGLVSATCFAELGA--NVRCIDTDRNKIEQLNSGTIPIYEPGLEKMIARNVKAGRLRFGTEIEQAVPEADIIFIAVGTP-----AG-E-DGSADMSYVLDAARSIGRAMS---RYILIVTKSTVPVGSYRLIRKAIQE---ELD---KREVLIDFDIASNPEFLKEGNAIDDFMKPDRVVVGVDS----D----RARELITSLYKPMLLNNF---R---VLFMDIASAEMTKYAANAMLATRISFMNDVANLCERVGADVSMVRLGIGSDSRIGSKFLYPGCGYGGSCFPKDVKALIRTAEDNGYR--MEVLEAVERVNEKQKSILFDKFS-T-YYKG-NVQGRCVAIWGLSFKPGTDDMREAPSLVLIEKLLEVGCRVRVYDPVAMKEAQKR------------L---------G----------DKVEYTT----DMYDAVRGAEALFHVTEWKEFRMPDWSAL-SQAMAASLVIDGRNVYE--L---------------------------------------------
21 PsiBlast_CBE 96.0348% 0 - C- -3GG2 ? D:[5-427] ---IAVVGIGYVGLVSATCFAELGA--NVRCIDTDRNKIEQLNSGTIPIYEPGLEKMIARNVKAGRLRFGTEIEQAVPEADIIFIAVGTP-----------GSADMSYVLDAARSIGRAMS---RYILIVTKSTVPVGSYRLIRKAIQE---ELD---KREVLIDFDIASNPEFLKEGNAIDDFMKPDRVVVGVDS----D----RARELITSLYKPMLLNNF---R---VLFMDIASAEMTKYAANAMLATRISFMNDVANLCERVGADVSMVRLGIGSDSRIGSKFLYPGCGYGGSCFPKDVKALIRTAEDNGYR--MEVLEAVERVNEKQKSILFDKFS-T-YYKG-NVQGRCVAIWGLSFKPGTDDMREAPSLVLIEKLLEVGCRVRVYDPVAMKEAQKR------------L---------G----------DKVEYTT----DMYDAVRGAEALFHVTEWKEFRMPDWSAL-SQAMAASLVIDGRNVYE--L---------------------------------------------
25 PsiBlast_CBE 83.0944% -36 - C3 -2Y0C ? D:[10-463] --NLTIIGSGSVGLVTGACLADIGH--DVFCLDVDQAKIDILNNGGVPIHEPGLKEVIARNRSAGRLRFSTDIEAAVAHGDVQFIAVGTP-----P--------DLQYVLAAARNIGRYMT---GFKVIVDKSTVPVGTAERVRAAVAEELAKRG---GD---QMFSVVSNPEFLKEGAAVDDFTRPDRIVIGCDDDVPGE----RARELMKKLYAPFNRNHE---R---TLYMDVRSAEFTKYAANAMLATRISFMNELANLADRFGADIEAVRRGIGSDPRIGYHFLYAGCGYGGSCFPKDVEALIRTADEHGQS--LQILKAVSSVNATQKRVLADKIV-A-RF-GEDLTGRTFAIWGLAFKPNTDDMREAPSRELIAELLSRGARIAAYDPVAQEEARRV------------I---------ALDLADHPSWLERLSFVD----DEAQAARDADALVIVTEWKIFKSPDFVAL-GRLWKTPVIFDGRNLYE--PETMSEQGIEYHPIGRPGSR--------------------------
5 PsiBlast_PDB 82.9344% -33 - C3 -2Y0D ? A:[11-463] ---LTIIGSGKVGLVTGACLADIGH--DVFCLDVDQAKIDILNNGGVPIHEPGLKEVIARNRSAGRLRFSTDIEAAVAHGDVQFIAVGTP-----PD-E---SADLQYVLAAARNIGRYMT---GFKVIVDKSTVPVGTAERVRAAVAEELAKRG---GD---QMFSVVSNPEFLKEGAAVDDFTRPDRIVIGCDDDVPGE----RARELMKKLYAPFNRNHE---R---TLYMDVRSAEFTKYAANAMLATRISFMNELANLADRFGADIEAVRRGIGSDPRIGYHFLYAGCGYGGSCFPKDVEALIRTADEHGQS--LQILKAVSSVNATQKRVLADKIV-A-RF-GEDLTGRTFAIWGLAFKPNTDDMREAPSRELIAELLSRGARIAAYDPVAQEEARRV------------I---------ALDLADHPSWLERLSFVD----DEAQAARDADALVIVTEWKIFKSPDFVAL-GRLWKTPVIFDGRNLYE--PETMSEQGIEYHPIGRPGSR--------------------------
3 PsiBlast_PDB 82.8044% -32 - C3 -2Y0E ? A:[10-463] --NLTIIGSGYVGLVTGACLADIGH--DVFCLDVDQAKIDILNNGGVPIHEPGLKEVIARNRSAGRLRFSTDIEAAVAHGDVQFIAVGTP-----PD-E-DGSADLQYVLAAARNIGRYMT---GFKVIVDKSTVPVGTAERVRAAVAEELAKRG---GD---QMFSVVSNPEFLKEGAAVDDFTRPDRIVIGCDDDVPGE----RARELMKKLYAPFNRNHE---R---TLYMDVRSAEFTKYAANAMLATRISFMNELANLADRFGADIEAVRRGIGSDPRIGYHFLYAGCGYGGSCFPKDVEALIRTADEHGQS--LQILKAVSSVNATQKRVLADKIV-A-RF-GEDLTGRTFAIWGLAFKPNTDDMREAPSRELIAELLSRGARIAAYDPVAQEEARRV------------I---------ALDLADHPSWLERLSFVD----DEAQAARDADALVIVTEWKIFKSPDFVAL-GRLWKTPVIFDGRNLYE--PETMSEQGIEYHPIGRPGSR--------------------------
28 PsiBlast_CBE 82.7844% -35 - C3 -2Y0D ? D:[11-463] ---LTIIGSGKVGLVTGACLADIGH--DVFCLDVDQAKIDILNNGGVPIHEPGLKEVIARNRSAGRLRFSTDIEAAVAHGDVQFIAVGTP-----P-----GSADLQYVLAAARNIGRYMT---GFKVIVDKSTVPVGTAERVRAAVAEELAKRG---GD---QMFSVVSNPEFLKEGAAVDDFTRPDRIVIGCDDDVPGE----RARELMKKLYAPFNRNHE---R---TLYMDVRSAEFTKYAANAMLATRISFMNELANLADRFGADIEAVRRGIGSDPRIGYHFLYAGCGYGGSCFPKDVEALIRTADEHGQS--LQILKAVSSVNATQKRVLADKIV-A-RF-GEDLTGRTFAIWGLAFKPNTDDMREAPSRELIAELLSRGARIAAYDPVAQEEARRV------------I---------ALDLADHPSWLERLSFVD----DEAQAARDADALVIVTEWKIFKSPDFVAL-GRLWKTPVIFDGRNLYE--PETMSEQGIEYHPIGRPGSR--------------------------
22 PsiBlast_CBE 82.3544% -34 - C3 -2Y0E ? D:[10-463] --NLTIIGSGYVGLVTGACLADIGH--DVFCLDVDQAKIDILNNGGVPIHEPGLKEVIARNRSAGRLRFSTDIEAAVAHGDVQFIAVGTP-----P--------DLQYVLAAARNIGRYMT---GFKVIVDKSTVPVGTAERVRAAVAEELAKRG---GD---QMFSVVSNPEFLKEGAAVDDFTRPDRIVIGCDDDVPGE----RARELMKKLYAPFNRNHE---R---TLYMDVRSAEFTKYAANAMLATRISFMNELANLADRFGADIEAVRRGIGSDPRIGYHFLYAGCGYGGSCFPKDVEALIRTADEHGQS--LQILKAVSSVNATQKRVLADKIV-A-RF-GEDLTGRTFAIWGLAFKPNTDDMREAPSRELIAELLSRGARIAAYDPVAQEEARRV------------I---------ALDLADHPSWLERLSFVD----DEAQAARDADALVIVTEWKIFKSPDFVAL-GRLWKTPVIFDGRNLYE--PETMSEQGIEYHPIGRPGSR--------------------------
30 PsiBlast_CBE 82.2144% -38 - C3 -2Y0D ? B:[11-461] ---LTIIGSGKVGLVTGACLADIGH--DVFCLDVDQAKIDILNNGGVPIHEPGLKEVIARNRSAGRLRFSTDIEAAVAHGDVQFIAVGTP------------SADLQYVLAAARNIGRYMT---GFKVIVDKSTVPVGTAERVRAAVAEELAKRG---G----QMFSVVSNPEFLKEGAAVDDFTRPDRIVIGCDDDVPGE----RARELMKKLYAPFNRNHE---R---TLYMDVRSAEFTKYAANAMLATRISFMNELANLADRFGADIEAVRRGIGSDPRIGYHFLYAGCGYGGSCFPKDVEALIRTADEHGQS--LQILKAVSSVNATQKRVLADKIV-A-RF-GEDLTGRTFAIWGLAFKPNTDDMREAPSRELIAELLSRGARIAAYDPVAQEEARRV------------I---------ALDLADHPSWLERLSFVD----DEAQAARDADALVIVTEWKIFKSPDFVAL-GRLWKTPVIFDGRNLYE--PETMSEQGIEYHPIGRPG----------------------------
4 PsiBlast_PDB 82.1644% -28 - C3 -2Y0C ? A:[10-463] --NLTIIGSGSVGLVTGACLADIGH--DVFCLDVDQAKIDILNNGGVPIHEPGLKEVIARNRSAGRLRFSTDIEAAVAHGDVQFIAVGTP-----PD-E-DGSADLQYVLAAARNIGRYMT---GFKVIVDKSTVPVGTAERVRAAVAEELAKRG---GD---QMFSVVSNPEFLKEGAAVDDFTRPDRIVIGCDDDVPGE----RARELMKKLYAPFNRNHE---R---TLYMDVRSAEFTKYAANAMLATRISFMNELANLADRFGADIEAVRRGIGSDPRIGYHFLYAGCGYGGSCFPKDVEALIRTADEHGQS--LQILKAVSSVNATQKRVLADKIV-A-RF-GEDLTGRTFAIWGLAFKPNTDDMREAPSRELIAELLSRGARIAAYDPVAQEEARRV------------I---------ALDLADHPSWLERLSFVD----DEAQAARDADALVIVTEWKIFKSPDFVAL-GRLWKTPVIFDGRNLYE--PETMSEQGIEYHPIGRPGSR--------------------------
23 PsiBlast_CBE 82.1444% -34 - C3 -2Y0E ? C:[10-463] --NLTIIGSGYVGLVTGACLADIGH--DVFCLDVDQAKIDILNNGGVPIHEPGLKEVIARNRSAGRLRFSTDIEAAVAHGDVQFIAVGTP-----PD-E-DGSADLQYVLAAARNIGRYMT---GFKVIVDKSTVPVGTAERVRAAVAEELAKR----------MFSVVSNPEFLKEGAAVDDFTRPDRIVIGCDDDVPGE----RARELMKKLYAPFNRNHE---R---TLYMDVRSAEFTKYAANAMLATRISFMNELANLADRFGADIEAVRRGIGSDPRIGYHFLYAGCGYGGSCFPKDVEALIRTADEHGQS--LQILKAVSSVNATQKRVLADKIV-A-RF-GEDLTGRTFAIWGLAFKPNTDDMREAPSRELIAELLSRGARIAAYDPVAQEEARRV------------I---------ALDLADHPSWLERLSFVD----DEAQAARDADALVIVTEWKIFKSPDFVAL-GRLWKTPVIFDGRNLYE--PETMSEQGIEYHPIGRPGSR--------------------------