@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu35990: (2016-07-31 )
MKILVLAVHPHMETSVVNKAWAEELSKHDNITVRDLYKEYPDEAIDVAKEQQLCEEYDRIVFQFPLYWYSSPPLLKKWQDLVLTYGWAFGSEGNALHGKELMLAVSTGSEAEKYQAGGANHYSISELLKPFQATSNLIGMKYLPPYVFYGVNYAAAEDISHSAKRLAEYIQQPFV

Atome Classification :

(45 SA) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------.........10.---.--......20.......-.30........40-..------------------------------.......50........60........70........80........90.------------.----......100.......110.......120.......-130.-.......140.......-150...-....----160.......170...--
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MKILVLAVHPHM---E--TSVVNKAWAEELSKH-DNITVRDLYKEY--PD------------------------------EAIDVAKEQQLCEEYDRIVFQFPLYWYSSPPLLKKWQDLVLTYGWAFGSE------------G----NALHGKELMLAVSTGSEAEKYQAGGANHYSISELLK-P-FQ-ATSNLIGMKYLPPYVFY-GVNYAA-AEDI----SHSAKRLAEYIQQPFV--
119 HHSearch 91.7836%-165 - C1 -3L9W KEFC_ECOLI (first) A:[237-406] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GMILIIYAHPYP---H--HSHANKRMLEQARTL-EGVEIRSLYQLY--PD------------------------------FNIDIAAEQEALSRADLIVWQHPMQWYSIPPLLKLWIDKVFSHGWAYGHG------------G----TALHGKHLLWAVTTGGGESHFEIGAH--PGFDVLSQ-P-LQ-ATAIYCGLNWLPPFAMH-CTFICD-DETL----EGQARHYKQRLLE-----
3 PsiBlast_PDB 90.7638%-170 - C1 -3L9W KEFC_ECOLI (first) A:[239-407] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ILIIYAHPYP---H--HSHANKRMLEQARTL-EGVEIRSLYQLY--PD------------------------------FNIDIAAEQEALSRADLIVWQHPMQWYSIPPLLKLWIDKVFSHGWAYGHG------------G----TALHGKHLLWAVTTGGGESHFEIGA--HPGFDVLSQ-P-LQ-ATAIYCGLNWLPPFAMH-CTFICD-DETLEGQARHYKQRLLEW--------
22 PsiBlast_CBE 88.9038%-171 - C1 -3L9W KEFC_ECOLI B:[239-407] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ILIIYAHPYP---H--HSHANKRMLEQARTL-EGVEIRSLYQLY--PD------------------------------FNIDIAAEQEALSRADLIVWQHPMQWYSIPPLLKLWIDKVFSHGWAYGHG------------G----TALHGKHLLWAVTTGGGESHFEIGA--HPGFDVLSQ-P-LQ-ATAIYCGLNWLPPFAMH-CTFICD-DETLEGQARHYKQRLLEW--------
21 PsiBlast_CBE 88.7938%-172 - C1 -3L9X KEFC_ECOLI B:[239-407] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ILIIYAHPYP---H--HSHANKRMLEQARTL-EGVEIRSLYQLY--PD------------------------------FNIDIAAEQEALSRADLIVWQHPMQWYSIPPLLKLWIDKVFSHGWAYGHG------------G----TALHGKHLLWAVTTGGGESHFEIGA--HPGFDVLSQ-P-LQ-ATAIYCGLNWLPPFAMH-CTFICD-DETLEGQARHYKQRLLEW--------
4 PsiBlast_PDB 88.4238%-168 - C1 -3L9X KEFC_ECOLI (first) A:[239-407] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ILIIYAHPYP---H--HSHANKRMLEQARTL-EGVEIRSLYQLY--PD------------------------------FNIDIAAEQEALSRADLIVWQHPMQWYSIPPLLKLWIDKVFSHGWAYGHG------------G----TALHGKHLLWAVTTGGGESHFEIGA--HPGFDVLSQ-P-LQ-ATAIYCGLNWLPPFAMH-CTFICD-DETLEGQARHYKQRLLEW--------
23 PsiBlast_CBE 87.3138%-171 - C1 -3EYW KEFC_ECOLI B:[239-407] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ILIIYAHPYP---H--HSHANKRMLEQARTL-EGVEIRSLYQLY--PD------------------------------FNIDIAAEQEALSRADLIVWQHPMQWYSIPPLLKLWIDKVFSHGWAYGHG------------G----TALHGKHLLWAVTTGGGESHFEIGA--HPGFDVLSQ-P-LQ-ATAIYCGLNWLPPFAMH-CTFICD-DETLEGQARHYKQRLLEW--------
2 PsiBlast_PDB 86.2538%-169 - C1 -3EYW KEFC_ECOLI (first) A:[239-407] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ILIIYAHPYP---H--HSHANKRMLEQARTL-EGVEIRSLYQLY--PD------------------------------FNIDIAAEQEALSRADLIVWQHPMQWYSIPPLLKLWIDKVFSHGWAYGHG------------G----TALHGKHLLWAVTTGGGESHFEIGA--HPGFDVLSQ-P-LQ-ATAIYCGLNWLPPFAMH-CTFICD-DETLEGQARHYKQRLLEW--------
111 HHSearch 78.8043% -37 - C1 -3F2V ? A:[2-175] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PKTLIILAHPNI---S--QSTVHKHWSDAVRQHTDRFTVHELYAVY--PQ------------------------------GKIDVAAEQKLIETHDSLVWQFPIYWFNCPPLLKQWLDEVLTYGWAYGSK------------G----KALKGRKIALAVSLGAPAADYRADGAVGCSVAEVLR-P-FE-LTAKYCNADYRPPFTFH-T-----SEAAR----QEVERSARDYL-------
1 PsiBlast_PDB 78.5944% -37 - C1 -3F2V ? A:[3-172] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------KTLIILAHPNI---S--QSTVHKHWSDAVRQHTDRFTVHELYAVY--PQ------------------------------GKIDVAAEQKLIETHDSLVWQFPIYWFNCPPLLKQWLDEVLTYGWAYGSK------------G----KALKGRKIALAVSLGAPAADYRADGAVGCSVAEVLR-P-FE-LTAKYCNADYRPPFTFHT--SEAA-RQEV----ERSAR-------------
115 HHSearch 76.8739% -90 - C1 -3HA2 ? A:[1-167] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MQTLIIVAHPELARSN--TQPFFKAAIENFS----NVTWHPLVA-------------------------------------DFNVEQEQSLLLQNDRIILEFPLYWYSAPALLKQWMDTVMTTKFATGH-------------Q----YALEGKELGIVVSTGDNGNAFQAGAAEKFTISELMR-P-FE-AFANKTKMMYLPILAVH-QFLYLE-PDAQ----QRLLVAYQQYATNV----
5 PsiBlast_PDB 70.7339%-153 - C1 -3HA2 ? A:[2-138] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------QTLIIVAHPEL---A--RSNTQPFFKAAIENF-SNVTWHPLVADF-------------------------------------NVEQEQSLLLQNDRIILEFPLYWYSAPALLKQWMDTVMTTKFATGHQ-----------------YALEGKELGIVVSTGDNGNAFQAGAAEKFTISELMR-P-FE-AFANKTKMMYLP---------------------------------------
101 Fugue 70.1135% -23 - C1 -3EYW KEFC_ECOLI (first) B:[5-411] MRVIIAGFGRFGQITGRLLLSSGVKMVVLDHDPDHIETLRKFGMKVFYGDATRMDLLESAGAAKAEVLINAIDDPQTNLQLTEMVKEHFPHLQIIARARDVDHYIRLRQAGVEKPERETFEGALKTGRLALESLGLGPYEARERADVFRRFNIQMVEEMAMVENDTKARAAVYKRTSAMILIIYAHPYP---H--HSHANKRMLEQARTL-EGVEIRSLYQLY--PD------------------------------FNIDIAAEQEALSRADLIVWQHPMQWYSIPPLLKLWIDKVFSHGWAYGHG------------G----TALHGKHLLWAVTTGGGESHFEIGAHPG--FDVLSQ-P-LQ-ATAIYCGLNWLPPFAMH-CTFICD-DETL----EGQARHYKQRLLEWQEAH
121 HHSearch 65.8731% -14 - C1 -4GI5 ? A:[23-241] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MKVLLIYAHPEP---RSLNGALKNFAIRHLQQAGHEVQVSDLYAMRWKAGYDADDSGAPPVGEFWRPTLDSKQAFAQGT-QSADIVAEQEKLLWADTVIFQFPLWWFSMPAIMKGWIDRVYAWGFAYGVGEHSDRHWGDRYGE----GTFVGKRAMLIVTAGGWAEHYSPRGIN-GPIDDILF-PIQH-GMLFYPGFEVLPPLVFY-RTDKTD-AGQF----ADQCAALAERLDTL----
120 HHSearch 62.1134% 6 - C1 -4FGL NQO2_HUMAN A:[6-217] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------KKVLIVYAHQEP---KSFNGSLKNVAVDELSRQGCTVTVSDLYAMNFEPRATDKDITGTLSNPEVFNYGVETHEAYKQRSLASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDIPGFYD--------S----GLLQGKLALLSVTTGGTAEMYTKTGVNGDS-RYFLWPL-QH-GTLHFCGFKVLAPQISF-APEIAS-EEER----KGMVAAWSQRLQTI----
28 PsiBlast_CBE 52.5940% -64 - C1 -4XDG NQO2_HUMAN A:[82-200] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDIP------------GFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDS-RYFLW-P-LQHGTLHFCGFKVLAPQISF-APEIAS-EEE-----------------------
50 PsiBlast_CBE 52.4540% -60 - C1 -4FGL NQO2_HUMAN C:[84-202] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDIP------------GFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDS-RYFLW-P-LQHGTLHFCGFKVLAPQISF-APEIAS-EEE-----------------------
17 PsiBlast_PDB 52.0240% -56 - C1 -4QOD NQO2_HUMAN A:[82-200] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDIP------------GFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDS-RYFLW-P-LQHGTLHFCGFKVLAPQISF-APEIAS-EEE-----------------------
81 PsiBlast_CBE 51.9340% -62 - C1 -3UXE NQO2_HUMAN A:[81-199] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDIP------------GFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDS-RYFLW-P-LQHGTLHFCGFKVLAPQISF-APEIAS-EEE-----------------------
35 PsiBlast_CBE 51.0940% -57 - C1 -4QOG NQO2_HUMAN B:[82-200] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDIP------------GFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDS-RYFLW-P-LQHGTLHFCGFKVLAPQISF-APEIAS-EEE-----------------------
27 PsiBlast_CBE 51.0240% -59 - C1 -4XDG NQO2_HUMAN B:[82-200] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDIP------------GFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDS-RYFLW-P-LQHGTLHFCGFKVLAPQISF-APEIAS-EEE-----------------------
29 PsiBlast_CBE 50.1340% -63 - C1 -4QOJ NQO2_HUMAN B:[82-200] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDIP------------GFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDS-RYFLW-P-LQHGTLHFCGFKVLAPQISF-APEIAS-EEE-----------------------
37 PsiBlast_CBE 50.1240% -59 - C1 -4QOE NQO2_HUMAN B:[82-200] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDIP------------GFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDS-RYFLW-P-LQHGTLHFCGFKVLAPQISF-APEIAS-EEE-----------------------
11 PsiBlast_PDB 50.0140% -57 - C1 -3OVM NQO2_HUMAN A:[82-200] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDIP------------GFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDS-RYFLW-P-LQHGTLHFCGFKVLAPQISF-APEIAS-EEE-----------------------
33 PsiBlast_CBE 49.9340% -61 - C1 -4QOH NQO2_HUMAN B:[82-200] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDIP------------GFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDS-RYFLW-P-LQHGTLHFCGFKVLAPQISF-APEIAS-EEE-----------------------
32 PsiBlast_CBE 49.4040% -61 - C1 -4QOI NQO2_HUMAN A:[82-200] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDIP------------GFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDS-RYFLW-P-LQHGTLHFCGFKVLAPQISF-APEIAS-EEE-----------------------
38 PsiBlast_CBE 49.0440% -59 - C1 -4QOD NQO2_HUMAN B:[82-200] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDIP------------GFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDS-RYFLW-P-LQHGTLHFCGFKVLAPQISF-APEIAS-EEE-----------------------
75 PsiBlast_CBE 48.4840% -52 - C1 -4GR9 NQO2_HUMAN A:[81-199] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDIP------------GFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDS-RYFLW-P-LQHGTLHFCGFKVLAPQISF-APEIAS-EEE-----------------------
62 PsiBlast_CBE 48.4540% -62 - C1 -4ZVN ? B:[81-199] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDIP------------GFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDS-RYFLW-P-LQHGTLHFCGFKVLAPQISF-APEIAS-EEE-----------------------
48 PsiBlast_CBE 48.2040% -57 - C1 -1ZX1 NQO2_HUMAN B:[82-200] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDIP------------GFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDS-RYFLW-P-LQHGTLHFCGFKVLAPQISF-APEIAS-EEE-----------------------
19 PsiBlast_PDB 47.9440% -59 - C1 -4QOF NQO2_HUMAN A:[82-200] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDIP------------GFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDS-RYFLW-P-LQHGTLHFCGFKVLAPQISF-APEIAS-EEE-----------------------
13 PsiBlast_PDB 47.8440% -56 - C1 -3OWX NQO2_HUMAN A:[82-200] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDIP------------GFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDS-RYFLW-P-LQHGTLHFCGFKVLAPQISF-APEIAS-EEE-----------------------
10 PsiBlast_PDB 47.7140% -63 - C1 -3GAM NQO2_HUMAN A:[82-200] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDIP------------GFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDS-RYFLW-P-LQHGTLHFCGFKVLAPQISF-APEIAS-EEE-----------------------
55 PsiBlast_CBE 47.6740% -53 - C1 -4FGJ NQO2_HUMAN B:[84-202] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDIP------------GFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDS-RYFLW-P-LQHGTLHFCGFKVLAPQISF-APEIAS-EEE-----------------------
85 PsiBlast_CBE 47.3240% -56 - C1 -3NHY NQO2_HUMAN A:[81-199] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDIP------------GFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDS-RYFLW-P-LQHGTLHFCGFKVLAPQISF-APEIAS-EEE-----------------------
93 PsiBlast_CBE 47.0940% -54 - C1 -3NHR NQO2_HUMAN A:[81-199] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDIP------------GFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDS-RYFLW-P-LQHGTLHFCGFKVLAPQISF-APEIAS-EEE-----------------------
91 PsiBlast_CBE 47.0840% -58 - C1 -3NHS NQO2_HUMAN A:[81-199] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDIP------------GFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDS-RYFLW-P-LQHGTLHFCGFKVLAPQISF-APEIAS-EEE-----------------------
73 PsiBlast_CBE 46.9840% -53 - C1 -4U7F NQO2_HUMAN A:[81-199] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDIP------------GFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDS-RYFLW-P-LQHGTLHFCGFKVLAPQISF-APEIAS-EEE-----------------------
71 PsiBlast_CBE 46.7540% -55 - C1 -4U7G NQO2_HUMAN A:[81-199] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDIP------------GFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDS-RYFLW-P-LQHGTLHFCGFKVLAPQISF-APEIAS-EEE-----------------------
9 PsiBlast_PDB 46.6440% -61 - C1 -3G5M NQO2_HUMAN A:[82-200] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDIP------------GFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDS-RYFLW-P-LQHGTLHFCGFKVLAPQISF-APEIAS-EEE-----------------------
87 PsiBlast_CBE 46.5440% -57 - C1 -3NHW NQO2_HUMAN A:[81-199] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDIP------------GFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDS-RYFLW-P-LQHGTLHFCGFKVLAPQISF-APEIAS-EEE-----------------------
16 PsiBlast_PDB 46.4540% -61 - C1 -3OX3 NQO2_HUMAN A:[82-200] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDIP------------GFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDS-RYFLW-P-LQHGTLHFCGFKVLAPQISF-APEIAS-EEE-----------------------
89 PsiBlast_CBE 45.7240% -58 - C1 -3NHU NQO2_HUMAN A:[81-199] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDIP------------GFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDS-RYFLW-P-LQHGTLHFCGFKVLAPQISF-APEIAS-EEE-----------------------
14 PsiBlast_PDB 45.5940% -61 - C1 -3OX1 NQO2_HUMAN A:[82-200] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDIP------------GFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDS-RYFLW-P-LQHGTLHFCGFKVLAPQISF-APEIAS-EEE-----------------------
97 PsiBlast_CBE 45.2040% -59 - C1 -3NHL