@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu36520: (2016-07-31 )
MSGQMFKVEIVTRPANFEKLKQELGKIGVTSLTFSNVHGCGLQKAHTELYRGVKIESNVYERLKIEIVVSKVPVDQVTETAKRVLKTGSPGDGKIFVYEISNTINIRTGEEGPEAL

Atome Classification :

(49 SA) .........10........20........30........40........50....-..-..60........70........80........90........100.......110....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MSGQMFKVEIVTRPANFEKLKQELGKIGVTSLTFSNVHGCGLQKAHTELYRGVKI-ES-NVYERLKIEIVVSKVPVDQVTETAKRVLKTGSPGDGKIFVYEISNTINIRTGEEGPEAL
113 HHSearch 91.6398%-138 - C4 -4R25 NRGB_BACSU A:[1-114] --SHMFKVEIVTRPANFEKLKQELGKIGVTSLTFSNVHGCGLQKAHTELYRGVKI-ES-NVYERLKIEIVVSKVPVDQVTETAKRVLKTGSPGDGKIFVYEISNTINIRTGEEGPEAL
2 PsiBlast_PDB 91.5399%-139 - C4 -4R25 NRGB_BACSU A:[2-114] ---HMFKVEIVTRPANFEKLKQELGKIGVTSLTFSNVHGCGLQKAHTELYRGVKI-ES-NVYERLKIEIVVSKVPVDQVTETAKRVLKTGSPGDGKIFVYEISNTINIRTGEEGPEAL
22 PsiBlast_CBE 91.20100%-126 - C4 -4RX6 NRGB_BACSU B:[7-121] -SGQMFKVEIVTRPANFEKLKQELGKIGVTSLTFSNVHGCGLQKAHTELYRGVKI-ES-NVYERLKIEIVVSKVPVDQVTETAKRVLKTGSPGDGKIFVYEISNTINIRTGEEGPEAL
21 PsiBlast_CBE 90.49100%-141 - C4 -4RX6 NRGB_BACSU D:[7-121] -SGQMFKVEIVTRPANFEKLKQELGKIGVTSLTFSNVHGCGLQK--------VKI-ES-NVYERLKIEIVVSKVPVDQVTETAKRVLKTGSPGDGKIFVYEISNTINIRTGEEGPEAL
1 PsiBlast_PDB 89.35100%-135 - C4 -4RX6 NRGB_BACSU A:[6-121] MSGQMFKVEIVTRPANFEKLKQELGKIGVTSLTFSNVHGCGLQKA--------KI-ES-NVYERLKIEIVVSKVPVDQVTETAKRVLKTGSPGDGKIFVYEISNTINIRTGEEGPEAL
81 PsiBlast_CBE 71.7935%-157 - C4 -3LF0 GLNB_MYCTU A:[2-114] ---HMKLITAIVKPFTLDDVKTSLEDAGVLGMTVSEIQGYGR-----------------DFVPKVRIEVVVDDSIVDKVVDSIVRAARTGKIGDGKVWVSPVDTIVRVRTGERGHDAL
52 PsiBlast_CBE 70.2441%-101 - C4 -2V5H GLNB_SYNE7 K:[1-108] ----MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKGQTERYRGSEY-TV-EFLQKLKLEIVVEDAQVDTVIDKIVAAARTGEIGDGKIFVSPVDQTIRIRTGEKN----
38 PsiBlast_CBE 69.7541%-142 - C4 -4C3K GLNB_SYNE7 B:[1-108] ----MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGF--------------------FLQKLKLEIVVEDAQVDTVIDKIVAAARTGEIGDGKIFVSPVDQTIRIRTGEKN----
80 PsiBlast_CBE 69.5535%-126 - C4 -3LF0 GLNB_MYCTU B:[2-114] ---HMKLITAIVKPFTLDDVKTSLEDAGVLGMTVSEIQGYGRQ-GHTEVYRGAEY-SV-DFVPKVRIEVVVDDSIVDKVVDSIVRAARTGKIGDGKVWVSPVDTIVRVRTGERGHDAL
49 PsiBlast_CBE 69.4141%-113 - C4 -2XUL GLNB_SYNE7 B:[1-112] ----MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKGQT----GSEY-TV-EFLQKLKLEIVVEDAQVDTVIDKIVAAARTGEIGDGKIFVSPVDQTIRIRTGEKNADAI
32 PsiBlast_CBE 69.3341% -93 - C4 -1QY7 GLNB_SYNE7 C:[1-112] ----MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKGQTERYRGAEY-TV-EFLQKLKLEIVVEDAQVDTVIDKIVAAARTGEIGDGKIFVSPVDQTIRIRTGEKNADAI
17 PsiBlast_PDB 69.1041%-115 - C4 -2XUL GLNB_SYNE7 A:[1-112] ----MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKGQT-------Y-TV-EFLQKLKLEIVVEDAQVDTVIDKIVAAARTGEIGDGKIFVSPVDQTIRIRTGEKNADAI
3 PsiBlast_PDB 68.9141%-118 - C4 -1PIL - GLNB_ECOLI A:[1-112] ----MKKIDAIIKPFKLDDVREALAEVGITGMTVTEVKGFGRQKGHTELYRGAEY-MV-DFLPKVKIEIVVPDDIVDTCVDTIIRTAQTGKIGDGKIFVFDVARVIRIRTGEEDDAAI
4 PsiBlast_PDB 68.9041%-111 - C4 -2PII - GLNB_ECOLI A:[1-112] ----MKKIDAIIKPFKLDDVREALAEVGITGMTVTEVKGFGRQKGHTELYRGAEY-MV-DFLPKVKIEIVVPDDIVDTCVDTIIRTAQTGKIGDGKIFVFDVARVIRIRTGEEDDAAI
118 HHSearch 68.7338%-124 - C4 -2NS1 GLNK_ECOLI B:[4-116] ---SMKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAELYRGAEF-SV-NFLPKVKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRTGEADEAAL
8 PsiBlast_PDB 68.7338%-124 - C4 -2NS1 GLNK_ECOLI B:[4-116] ---SMKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAELYRGAEF-SV-NFLPKVKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRTGEADEAAL
42 PsiBlast_CBE 68.7241%-107 - C4 -2XZW GLNB_SYNE7 F:[1-112] ----MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKGQTERY------TV-EFLQKLKLEIVVEDAQVDTVIDKIVAAARTGEIGDGKIFVSPVDQTIRIRTGEKNADAI
54 PsiBlast_CBE 68.5041% -85 - C4 -2V5H GLNB_SYNE7 I:[1-111] ----MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQK--TERYRGSEY-TV-EFLQKLKLEIVVEDAQVDTVIDKIVAAARTGEIGDGKIFVSPVDQTIRIRTGEKNADA-
119 HHSearch 68.3641%-118 - C4 -4AFF GLNB_SYNE7 A:[1-112] ----MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQK------RGSEY-TV-EFLQKLKLEIVVEDAQVDTVIDKIVAAARTGENGDGKIFVSPVDQTIRIRTGEKNADAI
14 PsiBlast_PDB 68.3641%-118 - C4 -4AFF GLNB_SYNE7 A:[1-112] ----MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQK------RGSEY-TV-EFLQKLKLEIVVEDAQVDTVIDKIVAAARTGENGDGKIFVSPVDQTIRIRTGEKNADAI
44 PsiBlast_CBE 68.1241%-126 - C4 -2XZW GLNB_SYNE7 D:[1-112] ----MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKG-----------TV-EFLQKLKLEIVVEDAQVDTVIDKIVAAARTGEIGDGKIFVSPVDQTIRIRTGEKNADAI
45 PsiBlast_CBE 67.6941%-101 - C4 -2XZW GLNB_SYNE7 C:[1-112] ----MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKGQTERYRGSEY-TV-EFLQKLKLEIVVEDAQVDTVIDKIVAAARTGEIGDGKIFVSPVDQTIRIRTGEKNADAI
41 PsiBlast_CBE 67.5641%-106 - C4 -2XZW GLNB_SYNE7 G:[1-112] ----MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKGQTE-----EY-TV-EFLQKLKLEIVVEDAQVDTVIDKIVAAARTGEIGDGKIFVSPVDQTIRIRTGEKNADAI
99 PsiBlast_CBE 67.0941%-103 - C4 -3N5B ? A:[1-112] ----MKKVEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKGQTERYRGSEY-TV-EFLQKLKVEIVVEDNQVDMVVDKIIAAARTGEIGDGKIFISPVEQVIRIRTGEKNTEAV
37 PsiBlast_CBE 66.6341%-127 - C4 -4C3K GLNB_SYNE7 C:[1-108] ----MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQ----------EY-TV-EFLQKLKLEIVVEDAQVDTVIDKIVAAARTGEIGDGKIFVSPVDQTIRIRTGEKN----
84 PsiBlast_CBE 66.3841% -95 - C4 -2J9E Y059_METJA B:[1-114] --GSMKKVEAIIRPEKLEIVKKALSDAGYVGMTVSEVKGRGVQGGIVERYRGREY-IV-DLIPKVKIELVVKEEDVDNVIDIICENARTGNPGDGKIFVIPVERVVRVRTKEEGKEAL
35 PsiBlast_CBE 66.2441%-125 - C4 -4C3K GLNB_SYNE7 E:[1-111] ----MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGR-----------------EFLQKLKLEIVVEDAQVDTVIDKIVAAARTGEIGDGKIFVSPVDQTIRIRTGEKNADA-
34 PsiBlast_CBE 66.1941%-121 - C4 -4C3K GLNB_SYNE7 F:[1-112] ----MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKG---------Y-TV-EFLQKLKLEIVVEDAQVDTVIDKIVAAARTGEIGDGKIFVSPVDQTIRIRTGEKNADAI
47 PsiBlast_CBE 66.0441%-108 - C4 -2XUL GLNB_SYNE7 E:[1-112] ----MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKGQTE----SEY-TV-EFLQKLKLEIVVEDAQVDTVIDKIVAAARTGEIGDGKIFVSPVDQTIRIRTGEKNADAI
40 PsiBlast_CBE 65.9441% -97 - C4 -2XZW GLNB_SYNE7 H:[1-109] ----MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKGQTERYRGSEY-TV-EFLQKLKLEIVVEDAQVDTVIDKIVAAARTGEIGDGKIFVSPVDQTIRIRTGEKNA---
48 PsiBlast_CBE 65.7041%-108 - C4 -2XUL GLNB_SYNE7 D:[1-112] ----MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKGQ--------Y-TV-EFLQKLKLEIVVEDAQVDTVIDKIVAAARTGEIGDGKIFVSPVDQTIRIRTGEKNADAI
46 PsiBlast_CBE 65.6741%-102 - C4 -2XZW GLNB_SYNE7 B:[1-112] ----MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKGQTER----EY-TV-EFLQKLKLEIVVEDAQVDTVIDKIVAAARTGEIGDGKIFVSPVDQTIRIRTGEKNADAI
78 PsiBlast_CBE 65.5641%-127 - C4 -1UL3 GLNB_SYNY3 A:[1-112] ----MKKVEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGF-------------------EFLQKLKIEIVVDEGQVDMVVDKLVSAARTGEIGDGKIFISPVDSVVRIRTGEKDTEAI
83 PsiBlast_CBE 65.4441% -87 - C4 -2J9E Y059_METJA C:[1-114] --GSMKKVEAIIRPEKLEIVKKALSDAGYVGMTVSEVKGRGVQGGIVERYRGREY-IV-DLIPKVKIELVVKEEDVDNVIDIICENARTGNPGDGKIFVIPVERVVRVRTKEEGKEAL
85 PsiBlast_CBE 65.3141% -99 - C4 -2J9E Y059_METJA A:[1-114] --GSMKKVEAIIRPEKLEIVKKALSDAGYVGMTVSEVKGRGVQGGIVERY----Y-IV-DLIPKVKIELVVKEEDVDNVIDIICENARTGNPGDGKIFVIPVERVVRVRTKEEGKEAL
36 PsiBlast_CBE 64.9841%-130 - C4 -4C3K GLNB_SYNE7 D:[1-112] ----MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGR---------------V-EFLQKLKLEIVVEDAQVDTVIDKIVAAARTGEIGDGKIFVSPVDQTIRIRTGEKNADAI
95 PsiBlast_CBE 64.4541% -94 - C4 -2J9C Y059_METJA C:[1-114] --GSMKKVEAIIRPEKLEIVKKALSDAGYVGMTVSEVKGRGVQGGIVERYRGREY-IV-DLIPKVKIELVVKEEDVDNVIDIICENARTGNPGDGKIFVIPVERVVRVRTKEEGKEAL
127 HHSearch 63.5935%-103 - C4 -3NCQ ? A:[1-111] ----MKKIEAIVRAEKFPEVKAALEERGFYGMTVTDVKGRGQQGGMQIQFRGRTM-EV-TLLPKVKLEIVVKDDAVEEVIGLIVNSAFTGSPGDGKIFIIPVEDVVRIRTGERGDDS-
97 PsiBlast_CBE 63.2241% -90 - C4 -2J9C Y059_METJA A:[1-114] --GSMKKVEAIIRPEKLEIVKKALSDAGYVGMTVSEVKGRGVQGGIVERYRGREY-IV-DLIPKVKIELVVKEEDVDNVIDIICENARTGNPGDGKIFVIPVERVVRVRTKEEGKEAL
128 HHSearch 62.7041% -92 - C4 -2J9C Y059_METJA A:[2-114] ---SMKKVEAIIRPEKLEIVKKALSDAGYVGMTVSEVKGRGVQGGIVERYRGREY-IV-DLIPKVKIELVVKEEDVDNVIDIICENARTGNPGDGKIFVIPVERVVRVRTKEEGKEAL
96 PsiBlast_CBE 62.5941% -91 - C4 -2J9C Y059_METJA B:[1-114] --GSMKKVEAIIRPEKLEIVKKALSDAGYVGMTVSEVKGRGVQGGIVERYRGREY-IV-DLIPKVKIELVVKEEDVDNVIDIICENARTGNPGDGKIFVIPVERVVRVRTKEEGKEAL
63 PsiBlast_CBE 61.7038% -85 - C4 -4CO1 ? A:[7-112] ----------IIKPFKLDEVREALTSLGIQGLTVSEVKGFGRQKGQTEIYRGAEY-SV-SFLPKVKVEVAVSDDQYEQVVEAIQKAANTGRIGDGKIFVLDIAQAVRIRTGETNTEAL
61 PsiBlast_CBE 61.6138% -88 - C4 -4CO2 ? A:[7-112] ----------IIKPFKLDEVREALTSLGIQGLTVSEVKGFGRQKGQTEIYRGAEY-SV-SFLPKVKVEVAVSDDQYEQVVEAIQKAANTGRIGDGKIFVLDIAQAVRIRTGETNTEAL
60 PsiBlast_CBE 61.5338% -88 - C4 -4CO2 ? B:[7-112] ----------IIKPFKLDEVREALTSLGIQGLTVSEVKGFGRQKGQTEIYRGAEY-SV-SFLPKVKVEVAVSDDQYEQVVEAIQKAANTGRIGDGKIFVLDIAQAVRIRTGETNTEAL
43 PsiBlast_CBE 61.4241%-122 - C4 -2XZW GLNB_SYNE7 E:[1-111] ----MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGR---------------V-EFLQKLKLEIVVEDAQVDTVIDKIVAAARTGEIGDGKIFVSPVDQTIRIRTGEKNADA-
122 HHSearch 61.0139% -59 - C4 -2O66 GLNB_ARATH A:[10-124] -DSKFYKVEAIVRPWRIQQVSSALLKIGIRGVTVSDVRGFG----------------EDKFVAKVKMEIVVKKDQVESVINTIIEGARTGEIGDGKIFVLPVSDVIRVRTGERGEKA-
62 PsiBlast_CBE 60.7638% -90 - C4 -4CO1 ? B:[7-112] ----------IIKPFKLDEVREALTSLGIQGLTVSEVKGFGRQKGQTEIYRGAEY-SV-SFLPKVKVEVAVSDDQYEQVVEAIQKAANTGRIGDGKIFVLDIAQAVRIRTGETNTEAL
114 HHSearch 60.1436% -55 - C4 -4USI ? A:[16-126] --VKFFRIEAIFRPWRLPFVIDTLSKYGIRGLTNTPVKGVGVQGGS-------EF-GPSNLVDKEKLDIVVSRAQVDAVVRLVAASAYTGEIGDGKIFVHPVAEVVRIRTAETG----
101 PsiBlast_CBE 57.5239% -32 - C4 -2RD5 GLNB_ARATH C:[12-124] ---KFYKVEAIVRPWRIQQVSSALLKIGIRGVTVSDVRGFGAQGGSTERHGGSEFSED-KFVAKVKMEIVVKKDQVESVINTIIEGARTGEIGDGKIFVLPVSDVIRVRTGERGEKA-