@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu36600: (2016-07-31 )
MRGGNRLGAGRKVIPESEKKKRKSVYITDKLYTRIMDTDIENCNNFSQKCMALIELAMENLNKNNQEHSVKRNNILMVRDTKSTYNKTNNNFEKQNRGIKLTFIDLFAGIGGIRLGFEDKYTKCVFSSEWDKYAAQTYEANYGEKPHGDITKINENDIPDQDVLLAGFPCQPFSNIGKREGFAHERRNIIFDVLRILKKKQPKMFLLENVKGLLTNDNGNTFRVILDNLKSLGYSVFYEVMDAQNFGLPQRRERIVIVGFHPDLGINDFSFPKGNPDNKVPINAILEHNPTGYSISKRLQESYLFKKDDGKPQIVDFRCTYQVNTLVASYHKIQRLTGTFVKDGETGLRLFSELELKRLMGFPVDFKVPVSRTQMYRQFGNSVAVPMIKAVAGAMKERLLLAEMQVLKK

Atome Classification :

(32 SA) .........10........20........30........40........50........60........70........80........90........100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210.......220.......230.......240.......250.......260.......270...-----------....280------.......290--...-------....300...------...-.310.-......320----------------------------.........330........340.......350.......360.......370........380.......390.......400.......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MRGGNRLGAGRKVIPESEKKKRKSVYITDKLYTRIMDTDIENCNNFSQKCMALIELAMENLNKNNQEHSVKRNNILMVRDTKSTYNKTNNNFEKQNRGIKLTFIDLFAGIGGIRLGFEDKYTKCVFSSEWDKYAAQTYEANYGEKPHGDITKINENDIPDQDVLLAGFPCQPFSNIGKREGFAHERRNIIFDVLRILKKKQPKMFLLENVKGLLTNDNGNTFRVILDNLKSLGYSVFYEVMDAQNFGLPQRRERIVIVGFHPDLGINDFSFPKGN-----------PDNKVPI------NAILEHNPTG--YSI-------SKRLQESYLF------KKD-DGKPQ-IVDFRCT------------------------------YQVNTLVASY-HKIQRLTGTFVKDGETGLRLFSELELKRLMGFPVDFKVPV-SRTQMYRQFGNSVAVPMIKAVAGAMKERLLLAEMQVLKK
7 PsiBlast_PDB 88.2939% -69 - C4 -8MHT MTH1_HAEPH A:[6-315] --------------------------------------------------------------------------------------------DKQLTGLR--FIDLFAGLGGFRLALESCGAECVYSNEWDKYAQEVYEMNFGEKPEGDITQVNEKTIPDHDILCAGFPCQAFSISGKQKGFEDSRGTLFFDIARIVREKKPKVVFMENVKNFASHDNGNTLEVVKNTMNELDYSFHAKVLNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKDLVMTNQEIE--QTT-------PKTVRLGIVG------KGG-QGE-R-IYSTRGI--------------------------------AITLSAYG-GGIFAKTGGYLVNGKT--RKLHPRECARVMGYPDSYKVHP-STSQAYKQFGNSVVINVLQYIA-----------------
19 PsiBlast_PDB 87.8139% -60 - C4 -5CIY ? A:[6-315] --------------------------------------------------------------------------------------------DKQLTGLR--FIDLFAGLGGFRLALESCGAECVYSNEWDKYAQEVYEMNFGEKPEGDITQVNEKTIPDHDILCAGFPCQAFSISGKQKGFEDSRGTLFFDIARIVREKKPKVVFMENVKNFASHDNGNTLEVVKNTMNELDYSFHAKVLNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKDLVMTNQEIE--QTT-------PKTVRLGIVG------KGG-QGE-R-IYSTRGI--------------------------------AITLSAYG-GGIFAKTGGYLVNGKT--RKLHPRECARVMGYPDSYKVHP-STSQAYKQFGNSVVINVLQYIA-----------------
31 PsiBlast_CBE 87.7139% -61 - C4 -2Z6A MTH1_HAEPH A:[6-315] --------------------------------------------------------------------------------------------DKQLTGLR--FIDLFAGLGGFRLALESCGAECVYSNEWDKYAQEVYEMNFGEKPEGDITQVNEKTIPDHDILCAGFPAQAFSISGKQKGFEDSRGTLFFDIARIVREKKPKVVFMENVKNFASHDNGNTLEVVKNTMNELDYSFHAKVLNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKDLVMTNQEIE--QTT-------PKTVRLGIVG------KGG-QGE-R-IYSTRGI--------------------------------AITLSAYG-GGIFAKTGGYLVNGKT--RKLHPRECARVMGYPDSYKVHP-STSQAYKQFGNSVVINVLQYIA-----------------
6 PsiBlast_PDB 87.0639% -63 - C4 -7MHT MTH1_HAEPH A:[6-315] --------------------------------------------------------------------------------------------DKQLTGLR--FIDLFAGLGGFRLALESCGAECVYSNEWDKYAQEVYEMNFGEKPEGDITQVNEKTIPDHDILCAGFPCQAFSISGKQKGFEDSRGTLFFDIARIVREKKPKVVFMENVKNFASHDNGNTLEVVKNTMNELDYSFHAKVLNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKDLVMTNQEIE--QTT-------PKTVRLGIVG------KGG-QGE-R-IYSTRGI--------------------------------AITLSAYG-GGIFAKTGGYLVNGKT--RKLHPRECARVMGYPDSYKVHP-STSQAYKQFGNSVVINVLQYIA-----------------
1 PsiBlast_PDB 87.0539% -64 - C4 -1MHT MTH1_HAEPH A:[6-315] --------------------------------------------------------------------------------------------DKQLTGLR--FIDLFAGLGGFRLALESCGAECVYSNEWDKYAQEVYEMNFGEKPEGDITQVNEKTIPDHDILCAGFPCQAFSISGKQKGFEDSRGTLFFDIARIVREKKPKVVFMENVKNFASHDNGNTLEVVKNTMNELDYSFHAKVLNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKDLVMTNQEIE--QTT-------PKTVRLGIVG------KGG-QGE-R-IYSTRGI--------------------------------AITLSAYG-GGIFAKTGGYLVNGKT--RKLHPRECARVMGYPDSYKVHP-STSQAYKQFGNSVVINVLQYIA-----------------
8 PsiBlast_PDB 87.0439% -65 - C4 -9MHT MTH1_HAEPH A:[6-315] --------------------------------------------------------------------------------------------DKQLTGLR--FIDLFAGLGGFRLALESCGAECVYSNEWDKYAQEVYEMNFGEKPEGDITQVNEKTIPDHDILCAGFPCQAFSISGKQKGFEDSRGTLFFDIARIVREKKPKVVFMENVKNFASHDNGNTLEVVKNTMNELDYSFHAKVLNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKDLVMTNQEIE--QTT-------PKTVRLGIVG------KGG-QGE-R-IYSTRGI--------------------------------AITLSAYG-GGIFAKTGGYLVNGKT--RKLHPRECARVMGYPDSYKVHP-STSQAYKQFGNSVVINVLQYIA-----------------
5 PsiBlast_PDB 86.7039% -62 - C4 -6MHT MTH1_HAEPH A:[6-315] --------------------------------------------------------------------------------------------DKQLTGLR--FIDLFAGLGGFRLALESCGAECVYSNEWDKYAQEVYEMNFGEKPEGDITQVNEKTIPDHDILCAGFPCQAFSISGKQKGFEDSRGTLFFDIARIVREKKPKVVFMENVKNFASHDNGNTLEVVKNTMNELDYSFHAKVLNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKDLVMTNQEIE--QTT-------PKTVRLGIVG------KGG-QGE-R-IYSTRGI--------------------------------AITLSAYG-GGIFAKTGGYLVNGKT--RKLHPRECARVMGYPDSYKVHP-STSQAYKQFGNSVVINVLQYIA-----------------
21 PsiBlast_CBE 86.6539% -59 - C4 -2UYH MTH1_HAEPH A:[6-315] --------------------------------------------------------------------------------------------DKQLTGLR--FIDLFAGLGGFRLALESCGAECVYSNEWDKYAQEVYEMNFGEKPEGDITQVNEKTIPDHDILCAGFPCQAFSIQGKQKGFEDSRGTLFFDIARIVREKKPKVVFMENVKNFASHDNGNTLEVVKNTMNELDYSFHAKVLNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKDLVMTNQEIE--QTT-------PKTVRLGIVG------KGG-SGE-R-IYSTRGI--------------------------------AITLSAYG-GGIFAKTGGYLVNGKT--RKLHPRECARVMGYPDSYKVHP-STSQAYKQFGNSVVINVLQYIA-----------------
42 HHSearch 86.5240% -64 * C4 *5CIY ? A:[8-325] ------------------------------------------------------------------------------------------------QLTGLRFIDLFAGLGGFRLALESCGAECVYSNEWDKYAQEVYEMNFGEKPEGDITQVNEKTIPDHDILCAGFPCQAFSISGKQKGFEDSRGTLFFDIARIVREKKPKVVFMENVKNFASHDNGNTLEVVKNTMNELDYSFHAKVLNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPF-----------E-LNTFV------KDLLLPDSEVEHLVIDRKDLVMTNQEIEQTTPKTVRLGIVGKGGQGERIYSTRGI------------------------------AI--TLSAYG-GGIFAKTGGYL--VNGKTRKLHPRECARVMGYPDSYKVHP-STSQAYKQFGNSVVINVLQYIAYNIGSSLNFK-------
25 PsiBlast_CBE 86.4339% -62 - C4 -2Z6U MTH1_HAEPH A:[6-315] --------------------------------------------------------------------------------------------DKQLTGLR--FIDLFAGLGGFRLALESCGAECVYSNEWDKYAQEVYEMNFGEKPEGDITQVNEKTIPDHDILCAGFPCQAFSISGKQKGFEDSRGTLFFDIARIVREKKPKVVFMANVKNFASHDNGNTLEVVKNTMNELDYSFHAKVLNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKDLVMTNQEIE--QTT-------PKTVRLGIVG------KGG-QGE-R-IYSTRGI--------------------------------AITLSAYG-GGIFAKTGGYLVNGKT--RKLHPRECARVMGYPDSYKVHP-STSQAYKQFGNSVVINVLQYIA-----------------
12 PsiBlast_PDB 86.2039% -62 - C4 -1SKM MTH1_HAEPH A:[6-315] --------------------------------------------------------------------------------------------DKQLTGLR--FIDLFAGLGGFRLALESCGAECVYSNEWDKYAQEVYEMNFGEKPEGDITQVNEKTIPDHDILCAGFPCQAFSISGKQKGFEDSRGTLFFDIARIVREKKPKVVFMENVKNFASHDNGNTLEVVKNTMNELDYSFHAKVLNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKDLVMTNQEIE--QTT-------PKTVRLGIVG------KGG-QGE-R-IYSTRGI--------------------------------AITLSAYG-GGIFAKTGGYLVNGKT--RKLHPRECARVMGYPDSYKVHP-STSQAYKQFGNSVVINVLQYIA-----------------
2 PsiBlast_PDB 86.0739% -65 - C4 -3MHT MTH1_HAEPH A:[6-315] --------------------------------------------------------------------------------------------DKQLTGLR--FIDLFAGLGGFRLALESCGAECVYSNEWDKYAQEVYEMNFGEKPEGDITQVNEKTIPDHDILCAGFPCQAFSISGKQKGFEDSRGTLFFDIARIVREKKPKVVFMENVKNFASHDNGNTLEVVKNTMNELDYSFHAKVLNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKDLVMTNQEIE--QTT-------PKTVRLGIVG------KGG-QGE-R-IYSTRGI--------------------------------AITLSAYG-GGIFAKTGGYLVNGKT--RKLHPRECARVMGYPDSYKVHP-STSQAYKQFGNSVVINVLQYIA-----------------
24 PsiBlast_CBE 86.0339% -61 - C4 -2ZCJ MTH1_HAEPH A:[6-315] --------------------------------------------------------------------------------------------DKQLTGLR--FIDLFAGLGGFRLALESCGAECVYSNEWDKYAQEVYEMNFGEKPEGDITQVNEKTIPDHDILCAGFPCQAFSISGKQKGFEDSRGTLFFDIARIVREKKPKVVFMQNVKNFASHDNGNTLEVVKNTMNELDYSFHAKVLNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKDLVMTNQEIE--QTT-------PKTVRLGIVG------KGG-QGE-R-IYSTRGI--------------------------------AITLSAYG-GGIFAKTGGYLVNGKT--RKLHPRECARVMGYPDSYKVHP-STSQAYKQFGNSVVINVLQYIA-----------------
34 Fugue 85.9838% -73 - C4 -6MHT MTH1_HAEPH A:[1-327] ----------------------------------------------------MIEIKDKQLTG-------------------------------------LRFIDLFAGLGGFRLALESCGAECVYSNEWDKYAQEVYEMNFGEKPEGDITQVNEKTIPDHDILCAGFPCQAFSISGKQKGFEDSRGTLFFDIARIVREKKPKVVFMENVKNFASHDNGNTLEVVKNTMNELDYSFHAKVLNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPF-----------ELNTFVK------DLLLPDSEVE--HLV-------IDRKDLVMTN------QEI-EQTTP-KTVRLGIVGKGGQGERIYSTRGIAITLSAYGGGIFAKTGGYLVN----------------GK---TRKLHPRECARVMGYPDSYKVH-PSTSQAYKQFGNSVVINVLQYIAYNIGSSLNFKPY-----
26 PsiBlast_CBE 85.9839% -59 - C4 -2Z6Q MTH1_HAEPH A:[6-315] --------------------------------------------------------------------------------------------DKQLTGLR--FIDLFAGLGGFRLALESCGAECVYSNEWDKYAQEVYEMNFGEKPEGDITQVNEKTIPDHDILCAGFPCQAFSISGKQKGFEDSRGTLFFDIARIVREKKPKVVFMENVKNFASHDNGNTLEVVKNTMNELDYSFHAKVLNALDYGIPQKREAIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKDLVMTNQEIE--QTT-------PKTVRLGIVG------KGG-QGE-R-IYSTRGI--------------------------------AITLSAYG-GGIFAKTGGYLVNGKT--RKLHPRECARVMGYPDSYKVHP-STSQAYKQFGNSVVINVLQYIA-----------------
3 PsiBlast_PDB 85.9639% -59 - C4 -4MHT MTH1_HAEPH A:[6-315] --------------------------------------------------------------------------------------------DKQLTGLR--FIDLFAGLGGFRLALESCGAECVYSNEWDKYAQEVYEMNFGEKPEGDITQVNEKTIPDHDILCAGFPCQAFSISGKQKGFEDSRGTLFFDIARIVREKKPKVVFMENVKNFASHDNGNTLEVVKNTMNELDYSFHAKVLNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKDLVMTNQEIE--QTT-------PKTVRLGIVG------KGG-QGE-R-IYSTRGI--------------------------------AITLSAYG-GGIFAKTGGYLVNGKT--RKLHPRECARVMGYPDSYKVHP-STSQAYKQFGNSVVINVLQYIA-----------------
27 PsiBlast_CBE 85.8139% -60 - C4 -2UZ4 MTH1_HAEPH A:[6-315] --------------------------------------------------------------------------------------------DKQLTGLR--FIDLFAGLGGFRLALESCGAECVYSNEWDKYAQEVYEMNFGEKPEGDITQVNEKTIPDHDILCAGFPCQAFSISGKQKGFEDSRGTLFFDIARIVREKKPKVVFMENVKNFASHDNGNTLEVVKNTMNELDYSFHAKVLNALDYGIPQKRENIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKDLVMTNQEIE--QTT-------PKTVRLGIVG------KGG-QGE-R-IYSTRGI--------------------------------AITLSAYG-GGIFAKTGGYLVNGKT--RKLHPRECARVMGYPDSYKVHP-STSQAYKQFGNSVVINVLQYIA-----------------
14 PsiBlast_PDB 85.7639% -57 - C4 -2C7P MTH1_HAEPH A:[6-315] --------------------------------------------------------------------------------------------DKQLTGLR--FIDLFAGLGGFRLALESCGAECVYSNEWDKYAQEVYEMNFGEKPEGDITQVNEKTIPDHDILCAGFPCQAFSISGKQKGFEDSRGTLFFDIARIVREKKPKVVFMENVKNFASHDNGNTLEVVKNTMNELDYSFHAKVLNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKDLVMTNQEIE--QTT-------PKTVRLGIVG------KGG-QGE-R-IYSTRGI--------------------------------AITLSAYG-GGIFAKTGGYLVNGKT--RKLHPRECARVMGYPDSYKVHP-STSQAYKQFGNSVVINVLQYIA-----------------
13 PsiBlast_PDB 85.7139% -59 - C4 -2C7O MTH1_HAEPH A:[6-315] --------------------------------------------------------------------------------------------DKQLTGLR--FIDLFAGLGGFRLALESCGAECVYSNEWDKYAQEVYEMNFGEKPEGDITQVNEKTIPDHDILCAGFPCQAFSISGKQKGFEDSRGTLFFDIARIVREKKPKVVFMENVKNFASHDNGNTLEVVKNTMNELDYSFHAKVLNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKDLVMTNQEIE--QTT-------PKTVRLGIVG------KGG-QGE-R-IYSTRGI--------------------------------AITLSAYG-GGIFAKTGGYLVNGKT--RKLHPRECARVMGYPDSYKVHP-STSQAYKQFGNSVVINVLQYIA-----------------