@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu37500: (2016-08-02 )
MSELWYTEKQTKNFGITMKVNKTLHTEQTEFQHLEMVETEEFGNMLFLDGMVMTSEKDEFVYHEMVAHVPLFTHPNPEHVLVVGGGDGGVIREILKHPSVKKATLVDIDGKVIEYSKKFLPSIAGKLDDPRVDVQVDDGFMHIAKSENQYDVIMVDSTEPVGPAVNLFTKGFYAGIAKALKEDGIFVAQTDNPWFTPELITNVQRDVKEIFPITKLYTANIPTYPSGLWTFTIGSKKYDPLAVEDSRFFDIETKYYTKDIHKAAFVLPKFVSDLIK

Atome Classification :

(43 SA) .........--10-.........20........30........40--.---........50........60........70........80........90........100.......110.......120.-......130.------......140...-.-...150.......160---.......170.......180.......190..-.....200-.......-210........220.......230....-...-----240.-----.-..---.------.---..250.......260.......270....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MSELWYTEK--Q--TKNFGITMKVNKTLHTEQTEFQHLEMVETE---E---FGNMLFLDGMVMTSEKDEFVYHEMVAHVPLFTHPNPEHVLVVGGGDGGVIREILKHPSVKKATLVDIDGKVIEYSKKFLPSI-AGKLDDPRVD------VQVDDGFMHIAK-S-ENQYDVIMVDSTEPVG---PAVNLFTKGFYAGIAKALKEDGIFVAQTDNPW-FTPELITN-VQRDVKE-I-FPITKLYTANIPTYPSGLWTFTIGSK-KYD-----P-LA-----V-ED---S------R---FFDIETKYYTKDIHKAAFVLPKFVSDLIK
105 HHSearch 95.07100% -93 - C1 -1IY9 - SPEE_BACSU A:[2-275] -SELWYTEK--Q--TKNFGITMKVNKTLHTEQTEFQHLEMVETE---E---FGNMLFLDGMVMTSEKDEFVYHEMVAHVPLFTHPNPEHVLVVGGGDGGVIREILKHPSVKKATLVDIDGKVIEYSKKFLPSI-AGKLDDPRVD------VQVDDGFMHIAK-S-ENQYDVIMVDSTEPVG---PAVNLFTKGFYAGIAKALKEDGIFVAQTDNPW-FTPELITN-VQRDVKE-I-FPITKLYTANIPTYPSGLWTFTIGSK-KYD-----P-LA-----V-ED---S------R---FFDIETKYYTKDIHKAAFVLPKFVSDLI-
1 PsiBlast_PDB 95.07100% -93 - C1 -1IY9 - SPEE_BACSU A:[2-275] -SELWYTEK--Q--TKNFGITMKVNKTLHTEQTEFQHLEMVETE---E---FGNMLFLDGMVMTSEKDEFVYHEMVAHVPLFTHPNPEHVLVVGGGDGGVIREILKHPSVKKATLVDIDGKVIEYSKKFLPSI-AGKLDDPRVD------VQVDDGFMHIAK-S-ENQYDVIMVDSTEPVG---PAVNLFTKGFYAGIAKALKEDGIFVAQTDNPW-FTPELITN-VQRDVKE-I-FPITKLYTANIPTYPSGLWTFTIGSK-KYD-----P-LA-----V-ED---S------R---FFDIETKYYTKDIHKAAFVLPKFVSDLI-
58 PsiBlast_CBE 71.2839% -92 - C1 -4CXM ? C:[17-276] ------------------AFSLKIKKILYETKSKYQNVLVFEST---T---YGKVLVLDGVIQLTEKDEFAYHEMMTHVPMTVSKEPKNVLVVGGGDGGIIRELCKYKSVENIDICEIDETVIEVSKIYFKNI-SCGYEDKRVN------VFIEDASKFLEN-V-TNTYDVIIVDSSDPIG---PAETLFNQNFYEKIYNALKPNGYCVAQCESLW-IHVGTIKN-MIGYAKK-L-FKKVEYANISIPTYPCGCIGILCCSK-TDT-----G-LTKPNKKL-ES---K------E---FADL--KYYNYENHSAAFKLPAFL-----
81 PsiBlast_CBE 71.2239% -96 - C1 -2I7C ? A:[17-276] ------------------AFSLKIKKILYETKSKYQNVLVFEST---T---YGKVLVLDGVIQLTEKDEFAYHEMMTHVPMTVSKEPKNVLVVGGGDGGIIRELCKYKSVENIDICEIDETVIEVSKIYFKNI-SCGYEDKRVN------VFIEDASKFLEN-V-TNTYDVIIVDSSDPIG---PAETLFNQNFYEKIYNALKPNGYCVAQCESLW-IHVGTIKN-MIGYAKK-L-FKKVEYANISIPTYPCGCIGILCCSK-TDT-----G-LTKPNKKL-ES---K------E---FADL--KYYNYENHSAAFKLPAFL-----
67 PsiBlast_CBE 71.1239% -92 - C1 -4BP1 ? C:[17-276] ------------------AFSLKIKKILYETKSKYQNVLVFEST---T---YGKVLVLDGVIQLTEKDEFAYHEMMTHVPMTVSKEPKNVLVVGGGDGGIIRELCKYKSVENIDICEIDETVIEVSKIYFKNI-SCGYEDKRVN------VFIEDASKFLEN-V-TNTYDVIIVDSSDPIG---PAETLFNQNFYEKIYNALKPNGYCVAQCESLW-IHVGTIKN-MIGYAKK-L-FKKVEYANISIPTYPCGCIGILCCSK-TDT-----G-LTKPNKKL-ES---K------E---FADL--KYYNYENHSAAFKLPAFL-----
80 PsiBlast_CBE 71.0639% -92 - C1 -2I7C ? B:[17-276] ------------------AFSLKIKKILYETKSKYQNVLVFEST---T---YGKVLVLDGVIQLTEKDEFAYHEMMTHVPMTVSKEPKNVLVVGGGDGGIIRELCKYKSVENIDICEIDETVIEVSKIYFKNI-SCGYEDKRVN------VFIEDASKFLEN-V-TNTYDVIIVDSSDPIG---PAETLFNQNFYEKIYNALKPNGYCVAQCESLW-IHVGTIKN-MIGYAKK-L-FKKVEYANISIPTYPCGCIGILCCSK-TDT-----G-LTKPNKKL-ES---K------E---FADL--KYYNYENHSAAFKLPAFL-----
65 PsiBlast_CBE 71.0139% -96 - C1 -4BP3 ? B:[17-276] ------------------AFSLKIKKILYETKSKYQNVLVFEST---T---YGKVLVLDGVIQLTEKDEFAYHEMMTHVPMTVSKEPKNVLVVGGGDGGIIRELCKYKSVENIDICEIDETVIEVSKIYFKNI-SCGYEDKRVN------VFIEDASKFLEN-V-TNTYDVIIVDSSDPIG---PAETLFNQNFYEKIYNALKPNGYCVAQCESLW-IHVGTIKN-MIGYAKK-L-FKKVEYANISIPTYPCGCIGILCCSK-TDT-----G-LTKPNKKL-ES---K------E---FADL--KYYNYENHSAAFKLPAFL-----
64 PsiBlast_CBE 70.9939% -93 - C1 -4BP3 ? C:[17-276] ------------------AFSLKIKKILYETKSKYQNVLVFEST---T---YGKVLVLDGVIQLTEKDEFAYHEMMTHVPMTVSKEPKNVLVVGGGDGGIIRELCKYKSVENIDICEIDETVIEVSKIYFKNI-SCGYEDKRVN------VFIEDASKFLEN-V-TNTYDVIIVDSSDPIG---PAETLFNQNFYEKIYNALKPNGYCVAQCESLW-IHVGTIKN-MIGYAKK-L-FKKVEYANISIPTYPCGCIGILCCSK-TDT-----G-LTKPNKKL-ES---K------E---FADL--KYYNYENHSAAFKLPAFL-----
59 PsiBlast_CBE 70.9839% -95 - C1 -4CXM ? B:[17-276] ------------------AFSLKIKKILYETKSKYQNVLVFEST---T---YGKVLVLDGVIQLTEKDEFAYHEMMTHVPMTVSKEPKNVLVVGGGDGGIIRELCKYKSVENIDICEIDETVIEVSKIYFKNI-SCGYEDKRVN------VFIEDASKFLEN-V-TNTYDVIIVDSSDPIG---PAETLFNQNFYEKIYNALKPNGYCVAQCESLW-IHVGTIKN-MIGYAKK-L-FKKVEYANISIPTYPCGCIGILCCSK-TDT-----G-LTKPNKKL-ES---K------E---FADL--KYYNYENHSAAFKLPAFL-----
79 PsiBlast_CBE 70.9039% -91 - C1 -2I7C ? C:[17-276] ------------------AFSLKIKKILYETKSKYQNVLVFEST---T---YGKVLVLDGVIQLTEKDEFAYHEMMTHVPMTVSKEPKNVLVVGGGDGGIIRELCKYKSVENIDICEIDETVIEVSKIYFKNI-SCGYEDKRVN------VFIEDASKFLEN-V-TNTYDVIIVDSSDPIG---PAETLFNQNFYEKIYNALKPNGYCVAQCESLW-IHVGTIKN-MIGYAKK-L-FKKVEYANISIPTYPCGCIGILCCSK-TDT-----G-LTKPNKKL-ES---K------E---FADL--KYYNYENHSAAFKLPAFL-----
85 PsiBlast_CBE 70.8639% -93 - C1 -4UOE ? C:[15-274] ------------------AFSLKIKKILYETKSKYQNVLVFEST---T---YGKVLVLDGVIQLTEKDEFAYHEMMTHVPMTVSKEPKNVLVVGGGDGGIIRELCKYKSVENIDICEIDETVIEVSKIYFKNI-SCGYEDKRVN------VFIEDASKFLEN-V-TNTYDVIIVDSSDPIG---PAETLFNQNFYEKIYNALKPNGYCVAQCESLW-IHVGTIKN-MIGYAKK-L-FKKVEYANISIPTYPCGCIGILCCSK-TDT-----G-LTKPNKKL-ES---K------E---FADL--KYYNYENHSAAFKLPAFL-----
70 PsiBlast_CBE 70.8239% -89 - C1 -3RIE ? C:[17-276] ------------------AFSLKIKKILYETKSKYQNVLVFEST---T---YGKVLVLDGVIQLTEKDEFAYHEMMTHVPMTVSKEPKNVLVVGGGDGGIIRELCKYKSVENIDICEIDETVIEVSKIYFKNI-SCGYEDKRVN------VFIEDASKFLEN-V-TNTYDVIIVDSSDPIG---PAETLFNQNFYEKIYNALKPNGYCVAQCESLW-IHVGTIKN-MIGYAKK-L-FKKVEYANISIPTYPCGCIGILCCSK-TDT-----G-LTKPNKKL-ES---K------E---FADL--KYYNYENHSAAFKLPAFL-----
74 PsiBlast_CBE 70.6939% -95 - C1 -3B7P ? B:[17-276] ------------------AFSLKIKKILYETKSKYQNVLVFEST---T---YGKVLVLDGVIQLTEKDEFAYHEMMTHVPMTVSKEPKNVLVVGGGDGGIIRELCKYKSVENIDICEIDETVIEVSKIYFKNI-SCGYEDKRVN------VFIEDASKFLEN-V-TNTYDVIIVDSSDPIG---PAETLFNQNFYEKIYNALKPNGYCVAQCESLW-IHVGTIKN-MIGYAKK-L-FKKVEYANISIPTYPCGCIGILCCSK-TDT-----G-LTKPNKKL-ES---K------E---FADL--KYYNYENHSAAFKLPAFL-----
61 PsiBlast_CBE 70.6939% -90 - C1 -4CWA ? C:[17-276] ------------------AFSLKIKKILYETKSKYQNVLVFEST---T---YGKVLVLDGVIQLTEKDEFAYHEMMTHVPMTVSKEPKNVLVVGGGDGGIIRELCKYKSVENIDICEIDETVIEVSKIYFKNI-SCGYEDKRVN------VFIEDASKFLEN-V-TNTYDVIIVDSSDPIG---PAETLFNQNFYEKIYNALKPNGYCVAQCESLW-IHVGTIKN-MIGYAKK-L-FKKVEYANISIPTYPCGCIGILCCSK-TDT-----G-LTKPNKKL-ES---K------E---FADL--KYYNYENHSAAFKLPAFL-----
68 PsiBlast_CBE 70.6839% -94 - C1 -4BP1 ? B:[17-276] ------------------AFSLKIKKILYETKSKYQNVLVFEST---T---YGKVLVLDGVIQLTEKDEFAYHEMMTHVPMTVSKEPKNVLVVGGGDGGIIRELCKYKSVENIDICEIDETVIEVSKIYFKNI-SCGYEDKRVN------VFIEDASKFLEN-V-TNTYDVIIVDSSDPIG---PAETLFNQNFYEKIYNALKPNGYCVAQCESLW-IHVGTIKN-MIGYAKK-L-FKKVEYANISIPTYPCGCIGILCCSK-TDT-----G-LTKPNKKL-ES---K------E---FADL--KYYNYENHSAAFKLPAFL-----
73 PsiBlast_CBE 70.5339% -91 - C1 -3B7P ? C:[17-276] ------------------AFSLKIKKILYETKSKYQNVLVFEST---T---YGKVLVLDGVIQLTEKDEFAYHEMMTHVPMTVSKEPKNVLVVGGGDGGIIRELCKYKSVENIDICEIDETVIEVSKIYFKNI-SCGYEDKRVN------VFIEDASKFLEN-V-TNTYDVIIVDSSDPIG---PAETLFNQNFYEKIYNALKPNGYCVAQCESLW-IHVGTIKN-MIGYAKK-L-FKKVEYANISIPTYPCGCIGILCCSK-TDT-----G-LTKPNKKL-ES---K------E---FADL--KYYNYENHSAAFKLPAFL-----
71 PsiBlast_CBE 70.4539% -97 - C1 -3RIE ? B:[17-276] ------------------AFSLKIKKILYETKSKYQNVLVFEST---T---YGKVLVLDGVIQLTEKDEFAYHEMMTHVPMTVSKEPKNVLVVGGGDGGIIRELCKYKSVENIDICEIDETVIEVSKIYFKNI-SCGYEDKRVN------VFIEDASKFLEN-V-TNTYDVIIVDSSDPIG---PAETLFNQNFYEKIYNALKPNGYCVAQCESLW-IHVGTIKN-MIGYAKK-L-FKKVEYANISIPTYPCGCIGILCCSK-TDT-----G-LTKPNKKL-ES---K------E---FADL--KYYNYENHSAAFKLPAFL-----
82 PsiBlast_CBE 70.3839% -89 - C1 -2HTE ? C:[17-276] ------------------AFSLKIKKILYETKSKYQNVLVFEST---T---YGKVLVLDGVIQLTEKDEFAYHEMMTHVPMTVSKEPKNVLVVGGGDGGIIRELCKYKSVENIDICEIDETVIEVSKIYFKNI-SCGYEDKRVN------VFIEDASKFLEN-V-TNTYDVIIVDSSDPIG---PAETLFNQNFYEKIYNALKPNGYCVAQCESLW-IHVGTIKN-MIGYAKK-L-FKKVEYANISIPTYPCGCIGILCCSK-TDT-----G-LTKPNKKL-ES---K------E---FADL--KYYNYENHSAAFKLPAFL-----
86 PsiBlast_CBE 70.3339% -97 - C1 -4UOE ? B:[15-274] ------------------AFSLKIKKILYETKSKYQNVLVFEST---T---YGKVLVLDGVIQLTEKDEFAYHEMMTHVPMTVSKEPKNVLVVGGGDGGIIRELCKYKSVENIDICEIDETVIEVSKIYFKNI-SCGYEDKRVN------VFIEDASKFLEN-V-TNTYDVIIVDSSDPIG---PAETLFNQNFYEKIYNALKPNGYCVAQCESLW-IHVGTIKN-MIGYAKK-L-FKKVEYANISIPTYPCGCIGILCCSK-TDT-----G-LTKPNKKL-ES---K------E---FADL--KYYNYENHSAAFKLPAFL-----
66 PsiBlast_CBE 70.2939% -97 - C1 -4BP3 ? A:[17-276] ------------------AFSLKIKKILYETKSKYQNVLVFEST---T---YGKVLVLDGVIQLTEKDEFAYHEMMTHVPMTVSKEPKNVLVVGGGDGGIIRELCKYKSVENIDICEIDETVIEVSKIYFKNI-SCGYEDKRVN------VFIEDASKFLEN-V-TNTYDVIIVDSSDPIG---PAETLFNQNFYEKIYNALKPNGYCVAQCESLW-IHVGTIKN-MIGYAKK-L-FKKVEYANISIPTYPCGCIGILCCSK-TDT-----G-LTKPNKKL-ES---K------E---FADL--KYYNYENHSAAFKLPAFL-----
76 PsiBlast_CBE 70.2039% -88 - C1 -2PWP ? C:[16-275] ------------------AFSLKIKKILYETKSKYQNVLVFEST---T---YGKVLVLDGVIQLTEKDEFAYHEMMTHVPMTVSKEPKNVLVVGGGDGGIIRELCKYKSVENIDICEIDETVIEVSKIYFKNI-SCGYEDKRVN------VFIEDASKFLEN-V-TNTYDVIIVDSSDPIG---PAETLFNQNFYEKIYNALKPNGYCVAQCESLW-IHVGTIKN-MIGYAKK-L-FKKVEYANISIPTYPCGCIGILCCSK-TDT-----G-LTKPNKKL-ES---K------E---FADL--KYYNYENHSAAFKLPAFL-----
84 PsiBlast_CBE 70.1639%-100 - C1 -2HTE ? A:[17-276] ------------------AFSLKIKKILYETKSKYQNVLVFEST---T---YGKVLVLDGVIQLTEKDEFAYHEMMTHVPMTVSKEPKNVLVVGGGDGGIIRELCKYKSVENIDICEIDETVIEVSKIYFKNI-SCGYEDKRVN------VFIEDASKFLEN-V-TNTYDVIIVDSS------------FNQNFYEKIYNALKPNGYCVAQCESLW-IHVGTIKN-MIGYAKK-L-FKKVEYANISIPTYPCGCIGILCCSK-TDT-----G-LTKPNKKL-ES---K------E---FADL--KYYNYENHSAAFKLPAFL-----
83 PsiBlast_CBE 70.1539%-100 - C1 -2HTE ? B:[17-276] ------------------AFSLKIKKILYETKSKYQNVLVFEST---T---YGKVLVLDGVIQLTEKDEFAYHEMMTHVPMTVSKEPKNVLVVGGGDGGIIRELCKYKSVENIDICEIDETVIEVSKIYFKNI-SCGYEDKRVN------VFIEDASKFLEN-V-TNTYDVIIVDSSD------------NQNFYEKIYNALKPNGYCVAQCESLW-IHVGTIKN-MIGYAKK-L-FKKVEYANISIPTYPCGCIGILCCSK-TDT-----G-LTKPNKKL-ES---K------E---FADL--KYYNYENHSAAFKLPAFL-----
60 PsiBlast_CBE 69.6839% -92 - C1 -4CXM ? A:[17-276] ------------------AFSLKIKKILYETKSKYQNVLVFEST---T---YGKVLVLDGVIQLTEKDEFAYHEMMTHVPMTVSKEPKNVLVVGGGDGGIIRELCKYKSVENIDICEIDETVIEVSKIYFKNI-SCGYEDKRVN------VFIEDASKFLEN-V-TNTYDVIIVDSSDPIG---PAETLFNQNFYEKIYNALKPNGYCVAQCESLW-IHVGTIKN-MIGYAKK-L-FKKVEYANISIPTYPCGCIGILCCSK-TDT-----G-LTKPNKKL-ES---K------E---FADL--KYYNYENHSAAFKLPAFL-----
75 PsiBlast_CBE 69.6439% -93 - C1 -3B7P ? A:[17-276] ------------------AFSLKIKKILYETKSKYQNVLVFEST---T---YGKVLVLDGVIQLTEKDEFAYHEMMTHVPMTVSKEPKNVLVVGGGDGGIIRELCKYKSVENIDICEIDETVIEVSKIYFKNI-SCGYEDKRVN------VFIEDASKFLEN-V-TNTYDVIIVDSSDPIG---PAETLFNQNFYEKIYNALKPNGYCVAQCESLW-IHVGTIKN-MIGYAKK-L-FKKVEYANISIPTYPCGCIGILCCSK-TDT-----G-LTKPNKKL-ES---K------E---FADL--KYYNYENHSAAFKLPAFL-----
69 PsiBlast_CBE 69.6439% -91 - C1 -4BP1 ? A:[17-276] ------------------AFSLKIKKILYETKSKYQNVLVFEST---T---YGKVLVLDGVIQLTEKDEFAYHEMMTHVPMTVSKEPKNVLVVGGGDGGIIRELCKYKSVENIDICEIDETVIEVSKIYFKNI-SCGYEDKRVN------VFIEDASKFLEN-V-TNTYDVIIVDSSDPIG---PAETLFNQNFYEKIYNALKPNGYCVAQCESLW-IHVGTIKN-MIGYAKK-L-FKKVEYANISIPTYPCGCIGILCCSK-TDT-----G-LTKPNKKL-ES---K------E---FADL--KYYNYENHSAAFKLPAFL-----
72 PsiBlast_CBE 69.5639% -91 - C1 -3RIE ? A:[17-276] ------------------AFSLKIKKILYETKSKYQNVLVFEST---T---YGKVLVLDGVIQLTEKDEFAYHEMMTHVPMTVSKEPKNVLVVGGGDGGIIRELCKYKSVENIDICEIDETVIEVSKIYFKNI-SCGYEDKRVN------VFIEDASKFLEN-V-TNTYDVIIVDSSDPIG---PAETLFNQNFYEKIYNALKPNGYCVAQCESLW-IHVGTIKN-MIGYAKK-L-FKKVEYANISIPTYPCGCIGILCCSK-TDT-----G-LTKPNKKL-ES---K------E---FADL--KYYNYENHSAAFKLPAFL-----
78 PsiBlast_CBE 69.5439% -90 - C1 -2PWP ? A:[16-275] ------------------AFSLKIKKILYETKSKYQNVLVFEST---T---YGKVLVLDGVIQLTEKDEFAYHEMMTHVPMTVSKEPKNVLVVGGGDGGIIRELCKYKSVENIDICEIDETVIEVSKIYFKNI-SCGYEDKRVN------VFIEDASKFLEN-V-TNTYDVIIVDSSDPIG---PAETLFNQNFYEKIYNALKPNGYCVAQCESLW-IHVGTIKN-MIGYAKK-L-FKKVEYANISIPTYPCGCIGILCCSK-TDT-----G-LTKPNKKL-ES---K------E---FADL--KYYNYENHSAAFKLPAFL-----
63 PsiBlast_CBE 69.5439% -90 - C1 -4CWA ? A:[17-276] ------------------AFSLKIKKILYETKSKYQNVLVFEST---T---YGKVLVLDGVIQLTEKDEFAYHEMMTHVPMTVSKEPKNVLVVGGGDGGIIRELCKYKSVENIDICEIDETVIEVSKIYFKNI-SCGYEDKRVN------VFIEDASKFLEN-V-TNTYDVIIVDSSDPIG---PAETLFNQNFYEKIYNALKPNGYCVAQCESLW-IHVGTIKN-MIGYAKK-L-FKKVEYANISIPTYPCGCIGILCCSK-TDT-----G-LTKPNKKL-ES---K------E---FADL--KYYNYENHSAAFKLPAFL-----
87 PsiBlast_CBE 69.1339% -90 - C1 -4UOE ? A:[15-274] ------------------AFSLKIKKILYETKSKYQNVLVFEST---T---YGKVLVLDGVIQLTEKDEFAYHEMMTHVPMTVSKEPKNVLVVGGGDGGIIRELCKYKSVENIDICEIDETVIEVSKIYFKNI-SCGYEDKRVN------VFIEDASKFLEN-V-TNTYDVIIVDSSDPIG---PAETLFNQNFYEKIYNALKPNGYCVAQCESLW-IHVGTIKN-MIGYAKK-L-FKKVEYANISIPTYPCGCIGILCCSK-TDT-----G-LTKPNKKL-ES---K------E---FADL--KYYNYENHSAAFKLPAFL-----
77 PsiBlast_CBE 69.1339% -96 - C1 -2PWP ? B:[16-275] ------------------AFSLKIKKILYETKSKYQNVLVFEST---T---YGKVLVLDGVIQLTEKDEFAYHEMMTHVPMTVSKEPKNVLVVGGGDGGIIRELCKYKSVENIDICEIDETVIEVSKIYFKNI-SCGYEDKRVN------VFIEDASKFLEN-V-TNTYDVIIVDSSDP-----------NQNFYEKIYNALKPNGYCVAQCESLW-IHVGTIKN-MIGYAKK-L-FKKVEYANISIPTYPCGCIGILCCSK-TDT-----G-LTKPNKKL-ES---K------E---FADL--KYYNYENHSAAFKLPAFL-----