@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu38810: (2016-08-04 )
MAELRMEHIYKFYDQKEPAVDDFNLHIADKEFIVFVGPSGCGKSTTLRMVAGLEEISKGDFYIEGKRVNDVAPKDRDIAMVFQNYALYPHMTVYDNIAFGLKLRKMPKPEIKKRVEEAAKILGLEEYLHRKPKALSGGQRQRVALGRAIVRDAKVFLMDEPLSNLDAKLRVQMRAEIIKLHQRLQTTTIYVTHDQTEALTMATRIVVMKDGKIQQIGTPKDVYEFPENVFVGGFIGSPAMNFFKGKLTDGLIKIGSAALTVPEGKMKVLREKGYIGKEVIFGIRPEDIHDELIVVESYKNSSIKAKINVAELLGSEIMIYSQIDNQDFIARIDARLDIQSGDELTVAFDMNKGHFFDSETEVRIR

Atome Classification :

(47 SA) .........10.......---.20........30........40........50........60.......----.----70-----.....-----..-..80........90----.........100.---..---.....110.......120....-...130.......140.......150.......160.......170.......180....---...190.......200.......210.......220.......230.......240......-.250---.-----..--.-...260..--.---....270..---.....280.......290..-...--..300.......310.......320...--.--...330.......340.......350.......360...
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MAELRMEHIYKFYDQKEP---AVDDFNLHIADKEFIVFVGPSGCGKSTTLRMVAGLEEISKGDFYIEGKRV----N----D------VAPKD-----RD-IAMVFQNYALYPH-----MTVYDNIAFG-LK---LR---KMPKPEIKKRVEEAAKILGLEE-YLHRKPKALSGGQRQRVALGRAIVRDAKVFLMDEPLSNLDAKLRVQMRAEIIKLHQRLQT---TTIYVTHDQTEALTMATRIVVMKDGKIQQIGTPKDVYEFPENVFVGGFIGSPAMNFFKGKLT-DGLI---K-----IG--S-AALTVPEG--K---MKVLREKGY---IGKEVIFGIRPEDIHDELIV-VES--YKNSSIKAKINVAELLGSEIMIYSQIDN--Q--DFIARIDARLDIQSGDELTVAFDMNKGHFFDSETEVRIR
7 PsiBlast_PDB 84.4648%-132 - C2 -1V43 - ? A:[10-369] MVEVKLENLTKRFGNFT----AVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGDRDV----T----Y------LPPKD-----RN-ISMVFQ------H-----MTVYENIAFP-L-----K---KFPKDEIDKRVRWAAELLQIEE-LLNRYPAQLSGGQRQRVAVARAIVVEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKLKV---TTIYVTHDQVEAMTMGDRIAVMNRGQLLQIGSPTEVYLRPNSVFVATFIGAPEMNILEVSVG-DGYL---E-----GR--G-FRIELPQ-------MDLLKD--Y---VGKTVLFGIRPEHMTVEGV---HM--KRTARLIGKVDFVEALGTDTILHVKFGD--E--LVKVKLPGHIPIEPGREVKVIMDLDMIHVFDKDTE----
6 PsiBlast_PDB 83.9248%-129 - C2 -1VCI ? A:[10-369] MVEVKLENLTKRFGNFT----AVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGDRDV----T----Y------LPPKD-----RN-ISMVFQ------H-----MTVYENIAFP-L-----K---KFPKDEIDKRVRWAAELLQIEE-LLNRYPAQLSGGQRQRVAVARAIVVEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKLKV---TTIYVTHDQVEAMTMGDRIAVMNRGQLLQIGSPTEVYLRPNSVFVATFIGAPEMNILEVSVG-DGYL---E-----GR--G-FRIELPQ-------MDLLKD--Y---VGKTVLFGIRPEHMTVEGV---HM--KRTARLIGKVDFVEALGTDTILHVKFGD--E--LVKVKLPGHIPIEPGREVKVIMDLDMIHVFDKDTE----
95 HHSearch 82.9749%-116 - C2 -1V43 - ? A:[10-372] MVEVKLENLTKRFG-NFT---AVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGDRDV----T----Y------LPPKD-----RN-ISMVFQ------H-----MTVYENIAFP-L-----K---KFPKDEIDKRVRWAAELLQIEE-LLNRYPAQLSGGQRQRVAVARAIVVEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKLKV---TTIYVTHDQVEAMTMGDRIAVMNRGQLLQIGSPTEVYLRPNSVFVATFIGAPEMNILEVSVG-DGYL---E-----GR--G-FRIELPQ-------M--DLLKDY---VGKTVLFGIRPEHMTVEGV-----HMKRTARLIGKVDFVEALGTDTILHVKFGD--E--LVKVKLPGHIPIEPGREVKVIMDLDMIHVFDKDTEKAI-
4 PsiBlast_PDB 82.7751% -78 - C2 -4XIG - ? S:[2-362] VASVSIQNVVKRYD-KTT---VVHGVSLDIEPGEFVVLVGPSGCGKSTTLRMVAGLEEISGGTIRIDGRVI----N----D------LAPKD-----RD-VAMVFQNYALYPH-----LNVRDNISFG-LR---LK---RTKKSVIDAAVKTAADILGLQP-LLERKPSDLSGGQRQRVAMGRAIVRDPKVFLFDQPLSNLDAKLRTQMRAEIKRLHQRLGT---TVIYVTHDQVEAMTLADRIVVMRDGLIEQIGKPMDLFLHPANTFVASFIGSPPMNLMPAR------I---A-----VD--S-TQHVELNGGNR---ISLLPRAGTHLAPGQEVVFGIRPEDV--TLDG-VEG--SERAQIKATVDIVEPLGSESILHATVGD--H--SLVVKVGGLNEVHPGDPVTLHVDLTRVHLFDAQSQASI-
5 PsiBlast_PDB 81.9451% -79 - C2 -4XTC - ? S:[2-362] VASVSIQNVVKRYD-KTT---VVHGVSLDIEPGEFVVLVGPSGCGKSTTLRMVAGLEEISGGTIRIDGRVI----N----D------LAPKD-----RD-VAMVFQNYALYPH-----LNVRDNISFG-LR---LK---RTKKSVIDAAVKTAADILGLQP-LLERKPSDLSGGQRQRVAMGRAIVRDPKVFLFDQPLSNLDAKLRTQMRAEIKRLHQRLGT---TVIYVTHDQVEAMTLADRIVVMRDGLIEQIGKPMDLFLHPANTFVASFIGSPPMNLMPAR------I---A-----VD--S-TQHVELNGGNR---ISLLPRAGTHLAPGQEVVFGIRPEDV--TLDG-VEG--SERAQIKATVDIVEPLGSESILHATVGD--H--SLVVKVGGLNEVHPGDPVTLHVDLTRVHLFDAQSQASI-
3 PsiBlast_PDB 80.3751% -79 - C2 -4TQV - ? C:[2-362] VASVSIQNVVKRYD-KTT---VVHGVSLDIEPGEFVVLVGPSGCGKSTTLRMVAGLEEISGGTIRIDGRVI----N----D------LAPKD-----RD-VAMVFQNYALYPH-----LNVRDNISFG-LR---LK---RTKKSVIDAAVKTAADILGLQP-LLERKPSDLSGGQRQRVAMGRAIVRDPKVFLFDQPLSNLDAKLRTQMRAEIKRLHQRLGT---TVIYVTHDQVEAMTLADRIVVMRDGLIEQIGKPMDLFLHPANTFVASFIGSPPMNLMPAR------I---A-----VD--S-TQHVELNGGNR---ISLLPRAGTHLAPGQEVVFGIRPEDV--TLDG-VEG--SERAQIKATVDIVEPLGSESILHATVGD--H--SLVVKVGGLNEVHPGDPVTLHVDLTRVHLFDAQSQASI-
2 PsiBlast_PDB 80.3751% -79 - C2 -4TQU - ? S:[2-362] VASVSIQNVVKRYD-KTT---VVHGVSLDIEPGEFVVLVGPSGCGKSTTLRMVAGLEEISGGTIRIDGRVI----N----D------LAPKD-----RD-VAMVFQNYALYPH-----LNVRDNISFG-LR---LK---RTKKSVIDAAVKTAADILGLQP-LLERKPSDLSGGQRQRVAMGRAIVRDPKVFLFDQPLSNLDAKLRTQMRAEIKRLHQRLGT---TVIYVTHDQVEAMTLADRIVVMRDGLIEQIGKPMDLFLHPANTFVASFIGSPPMNLMPAR------I---A-----VD--S-TQHVELNGGNR---ISLLPRAGTHLAPGQEVVFGIRPEDV--TLDG-VEG--SERAQIKATVDIVEPLGSESILHATVGD--H--SLVVKVGGLNEVHPGDPVTLHVDLTRVHLFDAQSQASI-
94 HHSearch 79.7551% -79 - C2 -4TQU - ? S:[2-362] VASVSIQNVVKRYD-KTT---VVHGVSLDIEPGEFVVLVGPSGCGKSTTLRMVAGLEEISGGTIRIDGRVI----N----D------LAPKD-----RD-VAMVFQNYALYPH-----LNVRDNISFG-LR---LK---RTKKSVIDAAVKTAADILGLQP-LLERKPSDLSGGQRQRVAMGRAIVRDPKVFLFDQPLSNLDAKLRTQMRAEIKRLHQRLGT---TVIYVTHDQVEAMTLADRIVVMRDGLIEQIGKPMDLFLHPANTFVASFIGSPPMNLMPARIA-VDSTQHVE-----LNG-G-NRISLLPR---------AGTHLA---PGQEVVFGIRPEDVTLDGVE-G----SERAQIKATVDIVEPLGSESILHATVGD--H--SLVVKVGGLNEVHPGDPVTLHVDLTRVHLFDAQSQASI-
100 HHSearch 78.0945% -86 - C2 -3RLF MALK_ECOLI A:[2-362] -ASVQLQNVTKAWG-EVV---VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRM----N----D------TPPAE-----RG-VGMVFQSYALYPH-----LSVAENMSFG-LK---LA---GAKKEVINQRVNQVAEVLQLAH-LLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGR---TMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVT-ATAI---DQVQVELPMPNRQQVWLPVE----------SRDVQ---VGANMSLGIRPEHLLPSDIA--------DVILEGEVQVVEQLGNETQIHIQIPS--IRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTAC--
15 PsiBlast_PDB 78.0644% -85 - C2 -3PUZ MALK_ECOLI A:[2-355] -ASVQLQNVTKAWGEVVV---S-KDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRM----N----D------TPPAE-----RG-VGMVFQSYALYPH-----LSVAENMSFG-LK---LA---GAKKEVINQRVNQVAEVLQLAH-LLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGR---TMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVT-ATAI---D-----QV--Q-VELPMPNR--QQVWLPVESRDVQ---VGANMSLGIRPEH-----LL-PSD--IADVILEGEVQVVEQLGNETQIHIQIPSIRQ--NLVYRQNDVVLVEEGATFAIGLPPERCHLF---------
17 PsiBlast_PDB 77.8344% -84 - C2 -3PUV MALK_ECOLI A:[2-355] -ASVQLQNVTKAWGEVVV---S-KDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRM----N----D------TPPAE-----RG-VGMVFQSYALYPH-----LSVAENMSFG-LK---LA---GAKKEVINQRVNQVAEVLQLAH-LLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGR---TMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVT-ATAI---D-----QV--Q-VELPMPNR--QQVWLPVESRDVQ---VGANMSLGIRPEH-----LL-PSD--IADVILEGEVQVVEQLGNETQIHIQIPSIRQ--NLVYRQNDVVLVEEGATFAIGLPPERCHLF---------
19 PsiBlast_PDB 77.6044% -82 - C2 -3PUX MALK_ECOLI A:[2-355] -ASVQLQNVTKAWGEVVV---S-KDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRM----N----D------TPPAE-----RG-VGMVFQSYALYPH-----LSVAENMSFG-LK---LA---GAKKEVINQRVNQVAEVLQLAH-LLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGR---TMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVT-ATAI---D-----QV--Q-VELPMPNR--QQVWLPVESRDVQ---VGANMSLGIRPEH-----LL-PSD--IADVILEGEVQVVEQLGNETQIHIQIPSIRQ--NLVYRQNDVVLVEEGATFAIGLPPERCHLF---------
1 PsiBlast_PDB 77.3153% 9 - C2 -2D62 ? A:[5-371] -AEVKLINIWKRFGDVT----AVKDLSLEIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTRGQIYIEDNLV----A----DPEKGVFVPPKE-----RD-VAMVFQSYALYPH-----MTVYDNIAFP-LK---LR---KVPKQEIDKRVREVAEMLGLTE-LLNRKPRELSGGQRQRVALGRAIIRRPKVFLMDEPLSNLDAKLRVKMRAELKKLQRQLGV---TTIYVTHDQVEAMTMGDRIAVMNKGELQQVGTPDEVYYKPVNTFVAGFIGSPPMNFLDATITDDGFL---D-----FG--E-FKLKLLQD--Q---FEVLEEENM---VGKEVIFGIRPEDVHDASFTHIDV--PEENTVKATVDIIENLGGEKIVHLRRGN--I--SFTAKFPKESKVREGDEVSVVFDMKKIHIFRKDTE----
20 PsiBlast_PDB 76.8644% -83 - C2 -3RLF MALK_ECOLI A:[2-355] -ASVQLQNVTKAWGEVVV---S-KDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRM----N----D------TPPAE-----RG-VGMVFQSYALYPH-----LSVAENMSFG-LK---LA---GAKKEVINQRVNQVAEVLQLAH-LLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGR---TMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVT-ATAI---D-----QV--Q-VELPMPNR--QQVWLPVESRDVQ---VGANMSLGIRPEH-----LL-PSD--IADVILEGEVQVVEQLGNETQIHIQIPSIRQ--NLVYRQNDVVLVEEGATFAIGLPPERCHLF---------
34 PsiBlast_CBE 76.5044% -77 - C2 -2R6G MALK_ECOLI (first) A:[2-355] -ASVQLQNVTKAWGEVVV---S-KDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRM----N----D------TPPAE-----RG-VGMVFQSYALYPH-----LSVAENMSFG-LK---LA---GAKKEVINQRVNQVAEVLQLAH-LLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDQPLSNLDAALRVQMRIEISRLHKRLGR---TMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVT-ATAI---D-----QV--Q-VELPMPNR--QQVWLPVESRDVQ---VGANMSLGIRPEH-----LL-PSD--IADVILEGEVQVVEQLGNETQIHIQIPSIRQ--NLVYRQNDVVLVEEGATFAIGLPPERCHLF---------
18 PsiBlast_PDB 76.4144% -80 - C2 -3PUW MALK_ECOLI A:[2-355] -ASVQLQNVTKAWGEVVV---S-KDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRM----N----D------TPPAE-----RG-VGMVFQSYALYPH-----LSVAENMSFG-LK---LA---GAKKEVINQRVNQVAEVLQLAH-LLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGR---TMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVT-ATAI---D-----QV--Q-VELPMPNR--QQVWLPVESRDVQ---VGANMSLGIRPEH-----LL-PSD--IADVILEGEVQVVEQLGNETQIHIQIPSIRQ--NLVYRQNDVVLVEEGATFAIGLPPERCHLF---------
22 PsiBlast_CBE 76.1844% -82 - C2 -4KI0 MALK_ECOLI A:[2-355] -ASVQLQNVTKAWGEVVV---S-KDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRM----N----D------TPPAE-----RG-VGMVFQSYALYPH-----LSVAENMSFG-LK---LA---GAKKEVINQRVNQVAEVLQLAH-LLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGR---TMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVT-ATAI---D-----QV--Q-VELPMPNR--QQVWLPVESRDVQ---VGANMSLGIRPEH-----LL-PSD--IADVILEGEVQVVEQLGNETQIHIQIPSIRQ--NLVYRQNDVVLVEEGATFAIGLPPERCHLF---------
21 PsiBlast_CBE 75.9344% -82 - C2 -4KI0 MALK_ECOLI B:[2-355] -ASVQLQNVTKAWGEVVV---S-KDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRM----N----D------TPPAE-----RG-VGMVFQSYALYPH-----LSVAENMSFG-LK---LA---GAKKEVINQRVNQVAEVLQLAH-LLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGR---TMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVT-ATAI---D-----QV--Q-VELPMPNR--QQVWLPVESRDVQ---VGANMSLGIRPEH-----LL-PSD--IADVILEGEVQVVEQLGNETQIHIQIPSIRQ--NLVYRQNDVVLVEEGATFAIGLPPERCHLF---------
14 PsiBlast_PDB 75.8044% -80 - C2 -3PUY MALK_ECOLI A:[2-355] -ASVQLQNVTKAWGEVVV---S-KDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRM----N----D------TPPAE-----RG-VGMVFQSYALYPH-----LSVAENMSFG-LK---LA---GAKKEVINQRVNQVAEVLQLAH-LLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGR---TMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVT-ATAI---D-----QV--Q-VELPMPNR--QQVWLPVESRDVQ---VGANMSLGIRPEH-----LL-PSD--IADVILEGEVQVVEQLGNETQIHIQIPSIRQ--NLVYRQNDVVLVEEGATFAIGLPPERCHLF---------
16 PsiBlast_PDB 75.7844% -76 - C2 -3PV0 - MALK_ECOLI A:[2-355] -ASVQLQNVTKAWGEVVV---S-KDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRM----N----D------TPPAE-----RG-VGMVFQSYALYPH-----LSVAENMSFG-LK---LA---GAKKEVINQRVNQVAEVLQLAH-LLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGR---TMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVT-ATAI---D-----QV--Q-VELPMPNR--QQVWLPVESRDVQ---VGANMSLGIRPEH-----LL-PSD--IADVILEGEVQVVEQLGNETQIHIQIPSIRQ--NLVYRQNDVVLVEEGATFAIGLPPERCHLF---------
49 PsiBlast_CBE 47.7237% -24 - C2 -3FVQ FBPC_NEIG1 B:[3-240] -AALHIGHLSKSF-QNTP---VLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTIFSKNT----N------LPVRE-----RR-LGYLVQEGVLFPH-----LTVYRNIAYG-LG---NG---KGRTAQERQRIEAMLELTGISE-LAGRYPHELSGGQQQRAALARALAPDPELILLDEPFSALDEQLRRQIREDMIAALRANGK---SAVFVSHDREEALQYADRIAVMKQGRILQTASPHELYRQPADLDAALFIG------------------------------------------------------------------------------------------------------------------------------------------------------------
50 PsiBlast_CBE 47.0337% -19 - C2 -3FVQ FBPC_NEIG1 A:[3-245] -AALHIGHLSKSF-QNTP---VLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTIFSKNT----N------LPVRE-----RR-LGYLVQEGVLFPH-----LTVYRNIAYG-LG---NG---KGRTAQERQRIEAMLELTGISE-LAGRYPHELSGGQQQRAALARALAPDPELILLDEPFSALDEQLRRQIREDMIAALRANGK---SAVFVSHDREEALQYADRIAVMKQGRILQTASPHELYRQPADLDAALFIG------------------------------------------------------------------------------------------------------------------------------------------------------------
101 HHSearch 46.0230% -6 - C2 -3FVQ FBPC_NEIG1 A:[2-349] TAALHIGHLSKSFQ-NTP---VLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTI----FSKNTN------LPVRE-----RR-LGYLVQEGVLFPH-----LTVYRNIAYG-LG---NG---KGRTAQERQRIEAMLELTGISE-LAGRYPHELSGGQQQRAALARALAPDPELILLDEPFSALDEQLRRQIREDMIAALRANGK---SAVFVSHDREEALQYADRIAVMKQGRILQTASPHELYRQPADLDAALFIGEG--IVFPAALN-ADGTA--D-----CR--L-GRLPVQ-------------SGAP---AGTRGTLLIRPEQYSLHPHS-A-----PAASIHAVVLKTTPKARHTEISLRAGQ--T--VLTLNL-----LSDGISAVLHLDGPALFFPG--------
78 PsiBlast_CBE 45.0734% -15 - C2 -4YMV ? J:[7-224] --------VYKNFGSLE----VLKGVTLKVNKGEVVVIIGPSGSGKSTLLRCINLLEEPTKGEVFIDGVKI----N----NGKVN--INKVR-----QK-VGMVFQHFNLFPH-----LTAIENITLAPVK---VK---KMNKKEAEELAVDLLAKVGLLD-KKDQYPIKLSGGQKQRLAIARALAMQPEVMLFDEPTSALDP----EMVKEVLNVMKQLANEGMTMVVVTHEMGFAREVGDRVIFMDDGVIVEEGTPEEIF-------------------------------------------------------------------------------------------------------------------------------------------------------------------------
59 PsiBlast_CBE 44.3335% -7 - C2 -3C4J ? B:[44-252] --------------------------NVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDGINLKAKDT----N------LNKVR-----EE-VGMVFQRFNLFPH-----MTVLNNITLAPMK---VR---KWPREKAEAKAMELLDKVGLKD-KAHAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDP----EMVGEVLSVMKQLANEGMTMVVVTHEMGFAREVGDRVLFMDGGYIIEEGKPEDLFDRPQH--------------------------------------------------------------------------------------------------------------------------------------------------------------------
79 PsiBlast_CBE 44.1634% -11 - C2 -4YMV ? A:[7-224] --------VYKNFGSLE----VLKGVTLKVNKGEVVVIIGPSGSGKSTLLRCINLLEEPTKGEVFIDGVKI----N----NGKVN--INKVR-----QK-VGMVFQHFNLFPH-----LTAIENITLAPVK---VK---KMNKKEAEELAVDLLAKVGLLD-KKDQYPIKLSGGQKQRLAIARALAMQPEVMLFDEPTSALDP----EMVKEVLNVMKQLANEGMTMVVVTHEMGFAREVGDRVIFMDDGVIVEEGTPEEIF-------------------------------------------------------------------------------------------------------------------------------------------------------------------------
58 PsiBlast_CBE 43.7735% -14 - C2 -3C41 ? J:[23-238] --------------------------NVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDGINLKAKDT----N------LNKVR-----EE-VGMVFQRFNLFPH-----MTVLNNITLAPMK---VR---KWPREKAEAKAMELLDKVGLKD-KAHAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDP----EMVGEVLSVMKQLANEGMTMVVVTHEMGFAREVGDRVLFMDGGYIIEEGKPEDLFDRPQHERTKAFL-------------------------------------------------------------------------------------------------------------------------------------------------------------
57 PsiBlast_CBE 43.4935% -18 - C2 -3C41 ? K:[23-238] --------------------------NVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDGINLKAKDT----N------LNKVR-----EE-VGMVFQRFNLFPH-----MTVLNNITLAPMK---VR---KWPREKAEAKAMELLDKVGLKD-KAHAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDP----EMVGEVLSVMKQLANEGMTMVVVTHEMGFAREVGDRVLFMDGGYIIEEGKPEDLFDRPQHERTKAFL-------------------------------------------------------------------------------------------------------------------------------------------------------------
67 PsiBlast_CBE 42.9035% -11 - C2 -2OLK ? D:[44-252] --------------------------NVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDGINLKAKDT----N------LNKVR-----EE-VGMVFQRFNLFPH-----MTVLNNITLAPMK---VR---KWPREKAEAKAMELLDKVGLKD-KAHAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDP----EMVGEVLSVMKQLANEGMTMVVVTHEMGFAREVGDRVLFMDGGYIIEEGKPEDLFDRPQH--------------------------------------------------------------------------------------------------------------------------------------------------------------------
69 PsiBlast_CBE 42.8435% -10 - C2 -2OLK ? B:[44-252] --------------------------NVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDGINLKAKDT----N------LNKVR-----EE-VGMVFQRFNLFPH-----MTVLNNITLAPMK---VR---KWPREKAEAKAMELLDKVGLKD-KAHAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDP----EMVGEVLSVMKQLANEGMTMVVVTHEMGFAREVGDRVLFMDGGYIIEEGKPEDLFDRPQH--------------------------------------------------------------------------------------------------------------------------------------------------------------------
70 PsiBlast_CBE 42.4935% -14 - C2 -2OLK ? A:[44-252] --------------------------NVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDGINLKAKDT----N------LNKVR-----EE-VGMVFQRFNLFPH-----MTVLNNITLAPMK---VR---KWPREKAEAKAMELLDKVGLKD-KAHAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDP----EMVGEVLSVMKQLANEGMTMVVVTHEMGFAREVGDRVLFMDGGYIIEEGKPEDLFDRPQH--------------------------------------------------------------------------------------------------------------------------------------------------------------------
60 PsiBlast_CBE 42.3535% -8 - C2 -3C4J ? A:[44-252] --------------------------NVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDGINLKAKDT----N------LNKVR-----EE-VGMVFQRFNLFPH-----MTVLNNITLAPMK---VR---KWPREKAEAKAMELLDKVGLKD-KAHAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDP----EMVGEVLSVMKQLANEGMTMVVVTHEMGFAREVGDRVLFMDGGYIIEEGKPEDLFDRPQH--------------------------------------------------------------------------------------------------------------------------------------------------------------------
61 PsiBlast_CBE 42.3435% -14 - C2 -2Q0H ? B:[44-252] --------------------------NVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDGINLKAKDT----N------LNKVR-----EE-VGMVFQRFNLFPH-----MTVLNNITLAPMK---VR---KWPREKAEAKAMELLDKVGLKD-KAHAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDP----EMVGEVLSVMKQLANEGMTMVVVTHEMGFAREVGDRVLFMDGGYIIEEGKPEDLFDRPQH--------------------------------------------------------------------------------------------------------------------------------------------------------------------
84 PsiBlast_CBE 42.2733% 20 - C2 -3TIF Y796_METJA B:[2-225] ---VKLKNVTKTYKMGEEIIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIKT----N----D------LDDDELTKIRRDKIGFVFQQFNLIPL-----LTALENVELP-LI---FKYRGAMSGEERRKRALECLKMAELEERFANHKPNQLSGGQQQRVAIARALANNPPIILADQPTWALDSKTGEKIMQLLKKLNEEDGK---TVVVVTHDINVA-RFGERIIYLKDGEVER---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------