@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu38910: (2016-08-04 )
MNKDKIRVALADDQPLVREGFRYVINAQTDMTVSGEAGDGHDIIALAKQTKPDVILMDVQMPRCSGIEAAKDIMSALPNTKIVILTTFDTEEYVFEGIRAGAVGYLLKDTLPEELIDAIRAAARGEAIFRTVTAAKIISETFRAKQQTHAEELAEPFTKRELEVLQQMAYGLRNEDIAEKLFVSESTVKTHVHRILQKCNAQDRTQAVVFAIRNGIVQ

Atome Classification :

(20 SA) .........10........20........30........40........50.-.......60........70........80........90........100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MNKDKIRVALADDQPLVREGFRYVINAQTDMTVSGEAGDGHDIIALAKQTKP-DVILMDVQMPRCSGIEAAKDIMSALPNTKIVILTTFDTEEYVFEGIRAGAVGYLLKDTLPEELIDAIRAAARGEAIFRTVTAAKIISETFRAKQQTHAEELAEPFTKRELEVLQQMAYGLRNEDIAEKLFVSESTVKTHVHRILQKCNAQDRTQAVVFAIRNGIVQ
21 PsiBlast_CBE 90.5738%-135 - C4 -4IF4 VRAR_STAAM D:[2-208] -----IKVLFVDDHEMVRIGISSYLSTQSDIEVVGEGASGKEAIAKAHELKP-DLILMDLLMEDMDGVEATTQIKKDLPQIKVLMLTSFIEDKEVYRALDAGVDSYILKTTSAKDIADAVRKTSRGESVFEPEVLVKM-----RNRMKKRA-ELYEMLTEREMEILLLIAKGYSNQEIASASHITIKTVKTHVSNILSKLEVQDRTQAVIYAFQHNLIQ
22 PsiBlast_CBE 89.0838%-134 - C4 -4IF4 VRAR_STAAM C:[2-208] -----IKVLFVDDHEMVRIGISSYLSTQSDIEVVGEGASGKEAIAKAHELKP-DLILMDLLMEDMDGVEATTQIKKDLPQIKVLMLTSFIEDKEVYRALDAGVDSYILKTTSAKDIADAVRKTSRGESVFEPEVLVKM-----RNRMKKRA-ELYEMLTEREMEILLLIAKGYSNQEIASASHITIKTVKTHVSNILSKLEVQDRTQAVIYAFQHNLIQ
2 PsiBlast_PDB 87.1338%-139 - C3 -4IF4 VRAR_STAAM A:[2-208] -----IKVLFVDDHEMVRIGISSYLSTQSDIEVVGEGASGKEAIAKAHELKP-DLILMDLLMEDMDGVEATTQIKKDLPQIKVLMLTSFIEDKEVYRALDAGVDSYILKTTSAKDIADAVRKTSRGESVFEPEVLVKM-----RNRMKKRA-ELYEMLTEREMEILLLIAKGYSNQEIASASHITIKTVKTHVSNILSKLEVQDRTQAVIYAFQHNLIQ
23 PsiBlast_CBE 86.6638%-136 - C3 -4IF4 VRAR_STAAM B:[2-208] -----IKVLFVDDHEMVRIGISSYLSTQSDIEVVGEGASGKEAIAKAHELKP-DLILMDLLMEDMDGVEATTQIKKDLPQIKVLMLTSFIEDKEVYRALDAGVDSYILKTTSAKDIADAVRKTSRGESVFEPEVLVKM-----RNRMKKRA-ELYEMLTEREMEILLLIAKGYSNQEIASASHITIKTVKTHVSNILSKLEVQDRTQAVIYAFQHNLIQ
1 PsiBlast_PDB 84.5238%-124 - C- -4GVP - VRAR_STAAM A:[3-209] -----IKVLFVDDHEMVRIGISSYLSTQSDIEVVGEGASGKEAIAKAHELKP-DLILMDLLMEDMDGVEATTQIKKDLPQIKVLMLTSFIEDKEVYRALDAGVDSYILKTTSAKDIADAVRKTSRGESVFEPEVLVKM-----RNRMKKRA-ELYEMLTEREMEILLLIAKGYSNQEIASASHITIKTVKTHVSNILSKLEVQDRTQAVIYAFQHNLIQ
111 HHSearch 81.4138%-125 - C- -4GVP - VRAR_STAAM A:[3-209] -----IKVLFVDDHEMVRIGISSYLSTQSDIEVVGEGASGKEAIAKAHELKP-DLILMDLLMEDMDGVEATTQIKKDLPQIKVLMLTSFIEDKEVYRALDAGVDSYILKTTSAKDIADAVRKTSRGESVFEPEV----LVKMRNR--MKKRAELYEMLTEREMEILLLIAKGYSNQEIASASHITIKTVKTHVSNILSKLEVQDRTQAVIYAFQHNLIQ
117 HHSearch 76.6437%-131 - C3 -4YN8 ? A:[4-203] ---GSIRVMLIDDHPVVRAGLRSILDSFDDITVVAEASDGS----NINTKGI-DVVVTDIQMPGTDGITLTRALAN-AGGPPVLILTTYDTEADILAAVEAGAMGYLLKDAPESALHDAVVATFEGRRTLAPEVAN----AL-----MQRVSKPRQALSAREIEILQNLEQGLSNRQLAAKLFISEATVKTHLVHIYSKLGVDNRTAAITAARQQRLI-
25 PsiBlast_CBE 75.7633%-123 - C3 -4LDZ DESR_BACSU B:[6-191] -----ISIFIAEDQQMLLGALGSLLNLEDDMEVVGKGTTGQDAVDFVKKRQP-DVCIMDIEMPGKTGLEAAEELKDT--GCKIIILTTFARPGYFQRAIKAGVKGYLLKDSPSEELANAIRSVMNGKRIYAPELMEDLYSE-------------ANPLTDREKEVLELVADGKNTKEIAQELSIKSGTVRNYISMILEKLEVKNRIE------------
5 PsiBlast_PDB 73.7133%-122 - C3 -4LDZ DESR_BACSU A:[6-198] -----ISIFIAEDQQMLLGALGSLLNLEDDMEVVGKGTTGQDAVDFVKKRQP-DVCIMDIEMPGKTGLEAAEELKDT--GCKIIILTTFARPGYFQRAIKAGVKGYLLKDSPSEELANAIRSVMNGKRIYAPELMEDLYSE-------------ANPLTDREKEVLELVADGKNTKEIAQELSIKSGTVRNYISMILEKLEVKNRIEAITRSKE-----
116 HHSearch 73.3035%-117 - C3 -4LDZ DESR_BACSU A:[4-198] ---SMISIFIAEDQQMLLGALGSLLNLEDDMEVVGKGTTGQDAVDFVKKRQP-DVCIMDIEMPGKTGLEAAEELKD--TGCKIIILTTFARPGYFQRAIKAGVKGYLLKDSPSEELANAIRSVMNGKRIYAPELM-------------EDLYSEANPLTDREKEVLELVADGKNTKEIAQELSIKSGTVRNYISMILEKLEVKNRIEAITRSKE-----
3 PsiBlast_PDB 72.5737% -91 - C3 -4YN8 ? A:[5-197] ----SIRVMLIDDHPVVRAGLRSILDSFDDITVVAEASDGSNI-----NTKGIDVVVTDIQMPGTDGITLTRALANA-GGPPVLILTTYDTEADILAAVEAGAMGYLLKDAPESALHDAVVATFEGRRTLAPEVANALMQRVSKPRQA---------LSAREIEILQNLEQGLSNRQLAAKLFISEATVKTHLVHIYSKLGVDNRTAAITAA-------
115 HHSearch 71.7334% -95 - C3 -1A04 - NARL_ECOLI A:[5-215] ---EPATILLIDDHPMLRTGVKQLISMAPDITVVGEASNGEQGIELAESLDP-DLILLDLNMPGMNGLETLDKLREKSLSGRIVVFSVSNHEEDVVTALKRGADGYLLKDMEPEDLLKALHQAAAGEMVLSEALTPVLAASL---------ERDVNQLTPRERDILKLIAQGLPNKMIARRLDITESTVKVHVKHMLKKMKLKSRVEAAVWVHQERI--
8 PsiBlast_PDB 71.0327%-114 - C3 -4HYE - ? A:[1-199] -----MKVLVAEDQSMLRDAMCQLLTLQPDVESVLQAKNGQEAIQLLEKESV-DIAILDVEMPVKTGLEVLEWIRSEKLETKVVVVTTFKRAGYFERAVKAGVDAYVLKERSIADLMQTLHTVLEGRKEYSPELMEMVMTR-------------PNPLTEQEIAVLKGIARGLSNQEIADQLYLSNGTIRNYVTNILSKLDAGNRTEAANIAKESGWL-
6 PsiBlast_PDB 69.9335% -96 - C3 -1A04 - NARL_ECOLI A:[5-209] ---EPATILLIDDHPMLRTGVKQLISMAPDITVVGEASNGEQGIELAESLDP-DLILLDLNMPGMNGLETLDKLREKSLSGRIVVFSVSNHEEDVVTALKRGADGYLLKDMEPEDLLKALHQAAAGEMVL-SEALTPVLAASL-------ERDVNQ-LTPRERDILKLIAQGLPNKMIARRLDITESTVKVHVKHMLKKMKLKSRVEAAVW--------
24 PsiBlast_CBE 69.8333%-131 - C3 -3C3W DEVR_MYCTU B:[2-204] -----VKVFLVDDHEVVRRGLVDLLGADPELDVVGEAGSVAEAMARVPAARP-DVAVLDVRLPDGNGIELCRDLLSRMPDLRCLILTSYTSDEAMLDAILAGASGYVVKDIKGMELARAVKDVGAGRSLLDNRAAAALMAKLRGAAEK---QDPLSGLTDQERTLLGLLSEGLTNKQIADRMFLAEKTVKNYVSRLLAKLGMERRTQAAVFA-------
7 PsiBlast_PDB 68.8435%-106 - C3 -1RNL NARL_ECOLI A:[4-208] ---EPATILLIDDHPMLRTGVKQLISMAPDITVVGEASNGEQGIELAESLDP-DLILLDLNMPGMNGLETLDKLREKSLSGRIVVFSVSNHEEDVVTALKRGADGYLLKDMEPEDLLKALHQAAAGEMVL-SEALTPVLAASL------------Q-LTPRERDILKLIAQGLPNKMIARRLDITESTVKVHVKHMLKKMKLKSRVEAAVW--------
110 HHSearch 68.8133%-120 - C3 -3C3W DEVR_MYCTU A:[2-209] -----VKVFLVDDHEVVRRGLVDLLGADPELDVVGEAGSVAEAMARVPAARP-DVAVLDVRLPDGNGIELCRDLLSRMPDLRCLILTSYTSDEAMLDAILAGASGYVVKDIKGMELARAVKDVGAGRSLLDNRAAAALMAKLRG---AAEKQDPLSGLTDQERTLLGLLSEGLTNKQIADRMFLAEKTVKNYVSRLLAKLGMERRTQAAVFATELKR--
4 PsiBlast_PDB 67.8233%-123 - C3 -3C3W DEVR_MYCTU A:[2-204] -----VKVFLVDDHEVVRRGLVDLLGADPELDVVGEAGSVAEAMARVPAARP-DVAVLDVRLPDGNGIELCRDLLSRMPDLRCLILTSYTSDEAMLDAILAGASGYVVKDIKGMELARAVKDVGAGRSLLDNRAAAALMAKLRGAAEK---QDPLSGLTDQERTLLGLLSEGLTNKQIADRMFLAEKTVKNYVSRLLAKLGMERRTQAAVFA-------
109 HHSearch 67.6626%-130 - C4 -5F64 - EVGA_SHIFL A:[0-203] ----AMNAIIIDDHPLAIAAIRNLLIK-NDIEILAELTEGGSAVQRVETLKP-DIVIIDVDIPGVNGIQVLETLRKRQYSGIIIIVSAKNDHFYGKHCADAGANGFVSKKEGMNNIIAAIEAAKNGYCYFPFSLNR-FVGS------LTSDQQKLDSLSKQEISVMRYILDGKDNNDIAEKMFISNKTVSTYKSRLMEKLECKSLMDLYTFAQRNKI--
113 HHSearch 67.3029%-121 - C3 -1YIO ? A:[3-200] ---AKPTVFVVDDDMSVREGLRNLLRS-AGFEVE-TFDCASTFLEHRRPEQH-GCLVLDMRMPGMSGIELQEQLTAISDGIPIVFITAHGDIPMTVRAMKAGAIEFLPKPFEEQALLDAIEQGLQLNAERRQA------RET-----QDQLEQLFSSLTGREQQVLQLTIRGLMNKQIAGELGIAEVTVKVHRHNIMQKLNVRSLANLVHLVEKY----