@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu39110: (2016-08-05 )
MSHFKNYQISHDILRALEGLGYTEPTKVQQSVIPAALERKDLVVKSQTGSGKTASFGIPLCELANWDENKPQALILTPTRELAVQVKEDITNIGRFKRIKATAVFGKSSFDKQKAELKQKSHIVVGTPGRVLDHIEKGTLPLDRLSYLVIDEADEMLNMGFIEQVEAIIKHLPTERTTMLFSATLPQDIEKLSRQYMQNPEHIEVKAAGLTTRNIEHAVIQVREENKFSLLKDVLMTENPDSCIIFCRTKEHVNQLTDELDDLGYPCDKIHGGMIQEDRFDVMNEFKRGEYRYLVATDVAARGIDIENISLVINYDLPLEKESYVHRTGRTGRAGNKGKAISFVTAFEKRFLADIEEYIGFEIQKIEAPSQEEVARKKPEFLAKLNDRPESKKDKSEELNKDIMKLYFNGGKKKKIRAVDFVGTIAKIDGVSADDIGIITIMDNASYVEILNGKGPHVLKVMKNTTVKGKQLKVNKANK

Atome Classification :

(66 SA) .........10......-..20........30.......--.--40........50........60.----------..---...------------------.---------.---70-------...-......80........90...-.-.-.----.---.100........110.....-..120.-........130...-.--.-.---.140.--......150.....-..-160........170-.----.-------..--....180.......190.......200....-..----.210--.....-....220-.-.-.-.-.----.----.230....-.----------.-.240-.......250.......260.---......270.......280.......290.......300.......310.......------320-----........330.......340..---.-...-.350........360........370.......380.......390.......400.......410.......420.......430.......440.......450.......460.......470.......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MSHFKNYQISHDILRAL-EGLGYTEPTKVQQSVIPAALE--R--KDLVVKSQTGSGKTASFGIPLCE----------LA---NWD------------------E---------N---K--------PQA-LILTPTRELAVQVKEDITNIG-R-F-K----R---IK-ATAVFGKSSFDKQKAEL-KQK--S-HIVVGTPGRVLDHI-E--K-G---TLPLD--RLSYLVIDEADEML-NM-G-FIEQVEAIIKH--L----P-------TE--RTTMLFSATLPQDIEKLSRQYMQNPEHIEVK-AA----GL----TTRNI-EHAVIQV-R-E-E-N-K----F----SLLKDVLM-T----------E-NPDS-CIIFCRTKEHVNQLTDELDDL---GYPCDKIHGGMIQEDRFDVMNEFKRGEYRYLVATDVAARGIDIENISLVINYDLPL------EK------ESYVHRTGRTGRAGNKGKAISFV---T-AFE-KRF-LADIEEYIG-FEIQKIEAPSQEEVARKKPEFLAKLNDRPESKKDKSEELNKDIMKLYFNGGKKKKIRAVDFVGTIAKIDGVSADDIGIITIMDNASYVEILNGKGPHVLKVMKNTTVKGKQLKVNKANK
24 PsiBlast_CBE 80.6939% -73 - C1 -2HYI IF4A3_HUMAN I:[40-403] ---FDTMGLREDLLRGI-YAYGFEKPSAIQQRAIKQIIK--G--RDVIAQSQSGTGKTATFSISVLQ----------CL---DIQ------------------V---------R---E--------TQA-LILAPTRELAVQIQKGLLALG-D-Y-M----N---VQ-CHACIGGTNVGEDIRKL-DYG--Q-HVVAGTPGRVFDMI-R--R-R---SLRTR--AIKMLVLDEADEML-NK-G-FKEQIYDVYRY--L----P-------PA--TQVVLISATLPHEILEMTNKFMTDPIRILVK-RD----EL----TLEGI-KQFFVAVER-E-E-W-K----F----DTLCDLYD-T----------L-TITQ-AVIFCNTKRKVDWLTEKMREA---NFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPN------NR------ELYIHRIGRSGRYGRKGVAINFV---K-NDD-IRI-LRDIEQYYS-TQIDEM-----------------------------------------------------------------------------------------------------------------
28 PsiBlast_CBE 80.5138% -88 - C1 -2VSO IF4A_YEAST B:[24-388] ---FDDMELDENLLRGV-FGYGFEEPSAIQQRAIMPIIE--G--HDVLAQAQSGTGKTGTFSIAALQ----------RI---DTS------------------V---------K---A--------PQA-LMLAPTRELALQIQKVVMALA-F-H-M----D---IK-VHACIG------------LRD--A-QIVVGTPGRVFDNI-Q--R-R---RFRTD--KIKMFILDEADEML-SS-G-FKEQIYQIFTL--L----P-------PT--TQVVLLSATMPNDVLEVTTKFMRNPVRILVK-KD----EL----TLEGI-KQFYVNV-E-E-E-EYK----Y----ECLTDLYD-S----------I-SVTQ-AVIFCNTRRKVEELTTKLRND---KFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPA------NK------ENYIHRIGR------KGVAINFV---T-NED-VGA-MRELEKFYS-TQIE--ELPS-------------------------------------------------------------------------------------------------------------
17 PsiBlast_PDB 80.2538% -87 - C1 -2VSO IF4A_YEAST A:[24-388] ---FDDMELDENLLRGV-FGYGFEEPSAIQQRAIMPIIE--G--HDVLAQAQSGTGKTGTFSIAALQ----------RI---DTS------------------V---------K---A--------PQA-LMLAPTRELALQIQKVVMALA-F-H-M----D---IK-VHACIG------------LRD--A-QIVVGTPGRVFDNI-Q--R-R---RFRTD--KIKMFILDEADEML-SS-G-FKEQIYQIFTL--L----P-------PT--TQVVLLSATMPNDVLEVTTKFMRNPVRILVK-KD----EL----TLEGI-KQFYVNV-E-E-E-EYK----Y----ECLTDLYD-S----------I-SVTQ-AVIFCNTRRKVEELTTKLRND---KFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPA------NK------ENYIHRIGR------KGVAINFV---T-NED-VGA-MRELEKFYS-TQIE--ELPS-------------------------------------------------------------------------------------------------------------
5 PsiBlast_PDB 80.2439% -77 - C1 -2HYI IF4A3_HUMAN C:[40-403] ---FDTMGLREDLLRGI-YAYGFEKPSAIQQRAIKQIIK--G--RDVIAQSQSGTGKTATFSISVLQ----------CL---DIQ------------------V---------R---E--------TQA-LILAPTRELAVQIQKGLLALG-D-Y-M----N---VQ-CHACIGGTNVGEDIRKL-DYG--Q-HVVAGTPGRVFDMI-R--R-R---SLRTR--AIKMLVLDEADEML-NK-G-FKEQIYDVYRY--L----P-------PA--TQVVLISATLPHEILEMTNKFMTDPIRILVK-RD----EL----TLEGI-KQFFVAVER-E-E-W-K----F----DTLCDLYD-T----------L-TITQ-AVIFCNTKRKVDWLTEKMREA---NFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPN------NR------ELYIHRIGRSGRYGRKGVAINFV---K-NDD-IRI-LRDIEQYYS-TQIDEM-----------------------------------------------------------------------------------------------------------------
3 PsiBlast_PDB 80.0739% -76 - C1 -2J0S IF4A3_HUMAN A:[39-402] ---FDTMGLREDLLRGI-YAYGFEKPSAIQQRAIKQIIK--G--RDVIAQSQSGTGKTATFSISVLQ----------CL---DIQ------------------V---------R---E--------TQA-LILAPTRELAVQIQKGLLALG-D-Y-M----N---VQ-CHACIGGTNVGEDIRKL-DYG--Q-HVVAGTPGRVFDMI-R--R-R---SLRTR--AIKMLVLDEADEML-NK-G-FKEQIYDVYRY--L----P-------PA--TQVVLISATLPHEILEMTNKFMTDPIRILVK-RD----EL----TLEGI-KQFFVAVER-E-E-W-K----F----DTLCDLYD-T----------L-TITQ-AVIFCNTKRKVDWLTEKMREA---NFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPN------NR------ELYIHRIGRSGRYGRKGVAINFV---K-NDD-IRI-LRDIEQYYS-TQIDEM-----------------------------------------------------------------------------------------------------------------
6 PsiBlast_PDB 80.0239% -78 - C1 -3EX7 IF4A3_HUMAN C:[40-403] ---FDTMGLREDLLRGI-YAYGFEKPSAIQQRAIKQIIK--G--RDVIAQSQSGTGKTATFSISVLQ----------CL---DIQ------------------V---------R---E--------TQA-LILAPTRELAVQIQKGLLALG-D-Y-M----N---VQ-CHACIGGTNVGEDIRKL-DYG--Q-HVVAGTPGRVFDMI-R--R-R---SLRTR--AIKMLVLDEADEML-NK-G-FKEQIYDVYRY--L----P-------PA--TQVVLISATLPHEILEMTNKFMTDPIRILVK-RD----EL----TLEGI-KQFFVAVER-E-E-W-K----F----DTLCDLYD-T----------L-TITQ-AVIFCNTKRKVDWLTEKMREA---NFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPN------NR------ELYIHRIGRSGRYGRKGVAINFV---K-NDD-IRI-LRDIEQYYS-TQIDEM-----------------------------------------------------------------------------------------------------------------
27 PsiBlast_CBE 79.8238% -86 - C1 -2VSX IF4A_YEAST B:[24-388] ---FDDMELDENLLRGV-FGYGFEEPSAIQQRAIMPIIE--G--HDVLAQAQSGTGKTGTFSIAALQ----------RI---DTS------------------V---------K---A--------PQA-LMLAPTRELALQIQKVVMALA-F-H-M----D---IK-VHACIG------------LRD--A-QIVVGTPGRVFDNI-Q--R-R---RFRTD--KIKMFILDEADEML-SS-G-FKEQIYQIFTL--L----P-------PT--TQVVLLSATMPNDVLEVTTKFMRNPVRILVK-KD----EL----TLEGI-KQFYVNV-E-E-E-EYK----Y----ECLTDLYD-S----------I-SVTQ-AVIFCNTRRKVEELTTKLRND---KFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPA------NK------ENYIHRIGR------KGVAINFV---T-NED-VGA-MRELEKFYS-TQIE--ELPS-------------------------------------------------------------------------------------------------------------
122 HHSearch 79.7335%-126 - C1 -1S2M - DHH1_YEAST A:[46-411] -NTFEDFYLKRELLMGI-FEAGFEKPSPIQEEAIPVAIT--G--RDILARAKNGTGKTAAFVIPTLE----------KV---KPK------------------L---------N---K--------IQA-LIMVPTRELALQTSQVVRTLG-K-H-C----G---IS-CMVTTGGTNLRDDILRL-NET--V-HILVGTPGRVLDLA-S--R-K---VADLS--DCSLFIMDEADKML-SR-D-FKTIIEQILSF--L----P-------PT--HQSLLFSATFPLTVKEFMVKHLHKPYEINLM-EE-----L----TLKGI-TQYYAFV-E-E-R-Q-K----L----HCLNTLFS-K----------L-QINQ-AIIFCNSTNRVELLAKKITDL---GYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRGIDIQAVNVVINFDFPK------TA------ETYLHRIGRSGRFGHLGLAINLI---N-WND-RFN-LYKIEQELG-TEIAAIPA---------------------------------------------------------------------------------------------------------------
4 PsiBlast_PDB 79.7139% -75 - C1 -2XB2 IF4A3_HUMAN A:[40-403] ---FDTMGLREDLLRGI-YAYGFEKPSAIQQRAIKQIIK--G--RDVIAQSQSGTGKTATFSISVLQ----------CL---DIQ------------------V---------R---E--------TQA-LILAPTRELAVQIQKGLLALG-D-Y-M----N---VQ-CHACIGGTNVGEDIRKL-DYG--Q-HVVAGTPGRVFDMI-R--R-R---SLRTR--AIKMLVLDEADEML-NK-G-FKEQIYDVYRY--L----P-------PA--TQVVLISATLPHEILEMTNKFMTDPIRILVK-RD----EL----TLEGI-KQFFVAVER-E-E-W-K----F----DTLCDLYD-T----------L-TITQ-AVIFCNTKRKVDWLTEKMREA---NFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPN------NR------ELYIHRIGRSGRYGRKGVAINFV---K-NDD-IRI-LRDIEQYYS-TQIDEM-----------------------------------------------------------------------------------------------------------------
18 PsiBlast_PDB 79.6238% -85 - C1 -2VSX IF4A_YEAST A:[24-388] ---FDDMELDENLLRGV-FGYGFEEPSAIQQRAIMPIIE--G--HDVLAQAQSGTGKTGTFSIAALQ----------RI---DTS------------------V---------K---A--------PQA-LMLAPTRELALQIQKVVMALA-F-H-M----D---IK-VHACIG------------LRD--A-QIVVGTPGRVFDNI-Q--R-R---RFRTD--KIKMFILDEADEML-SS-G-FKEQIYQIFTL--L----P-------PT--TQVVLLSATMPNDVLEVTTKFMRNPVRILVK-KD----EL----TLEGI-KQFYVNV-E-E-E-EYK----Y----ECLTDLYD-S----------I-SVTQ-AVIFCNTRRKVEELTTKLRND---KFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPA------NK------ENYIHRIGR------KGVAINFV---T-NED-VGA-MRELEKFYS-TQIE--ELPS-------------------------------------------------------------------------------------------------------------
22 PsiBlast_CBE 79.6039% -76 - C1 -2XB2 IF4A3_HUMAN X:[40-403] ---FDTMGLREDLLRGI-YAYGFEKPSAIQQRAIKQIIK--G--RDVIAQSQSGTGKTATFSISVLQ----------CL---DIQ------------------V---------R---E--------TQA-LILAPTRELAVQIQKGLLALG-D-Y-M----N---VQ-CHACIGGTNVGEDIRKL-DYG--Q-HVVAGTPGRVFDMI-R--R-R---SLRTR--AIKMLVLDEADEML-NK-G-FKEQIYDVYRY--L----P-------PA--TQVVLISATLPHEILEMTNKFMTDPIRILVK-RD----EL----TLEGI-KQFFVAVER-E-E-W-K----F----DTLCDLYD-T----------L-TITQ-AVIFCNTKRKVDWLTEKMREA---NFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPN------NR------ELYIHRIGRSGRYGRKGVAINFV---K-NDD-IRI-LRDIEQYYS-TQIDEM-----------------------------------------------------------------------------------------------------------------
21 PsiBlast_CBE 79.3739% -73 - C1 -2J0Q IF4A3_HUMAN B:[39-402] ---FDTMGLREDLLRGI-YAYGFEKPSAIQQRAIKQIIK--G--RDVIAQSQSGTGKTATFSISVLQ----------CL---DIQ------------------V---------R---E--------TQA-LILAPTRELAVQIQKGLLALG-D-Y-M----N---VQ-CHACIGGTNVGEDIRKL-DYG--Q-HVVAGTPGRVFDMI-R--R-R---SLRTR--AIKMLVLDEADEML-NK-G-FKEQIYDVYRY--L----P-------PA--TQVVLISATLPHEILEMTNKFMTDPIRILVK-RD----EL----TLEGI-KQFFVAVER-E-E-W-K----F----DTLCDLYD-T----------L-TITQ-AVIFCNTKRKVDWLTEKMREA---NFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPN------NR------ELYIHRIGRSGRYGRKGVAINFV---K-NDD-IRI-LRDIEQYYS-TQIDEM-----------------------------------------------------------------------------------------------------------------
26 PsiBlast_CBE 79.2342% -25 - C1 -4KBF ? B:[3-364] ---FKDFPLKPEILEAL-HGRGLTTPTPIQAAALPLALE--G--KDLIGQARTGTGKTLAFALPIAER---------LA---PSQ------------------ERG-------R---K--------PRA-LVLTPTRELALQVASELTAVA-----P----H---LK-VVAVYGGTGYGKQKEAL-LRG--A-DAVVATPGRALDYL-R--Q-G---VLDLS--RVEVAVLDEADEML-SM-G-FEEEVEALLSA--T----P-------PS--RQTLLFSATLPSWAKRLAERYMKNPVLINVI-KD----EP----VTYEE-EAVPAPV-R-----G-R----L----EVLSDLLY-V----------A-SPDR-AMVFTRTKAETEEIAQGLLRL---GHPAQALHGDLSQGERERVLGAFRQGEVRVLVATDVAARGLDIPQVDLVVHYRLPD------RA------EAYQHRSGRTGRAGRGGRVVLLY---G-PRE-RRD-VEALERAVG-RRFKRV-----------------------------------------------------------------------------------------------------------------
2 PsiBlast_PDB 78.9639% -72 - C1 -2J0Q IF4A3_HUMAN A:[39-402] ---FDTMGLREDLLRGI-YAYGFEKPSAIQQRAIKQIIK--G--RDVIAQSQSGTGKTATFSISVLQ----------CL---DIQ------------------V---------R---E--------TQA-LILAPTRELAVQIQKGLLALG-D-Y-M----N---VQ-CHACIGGTNVGEDIRKL-DYG--Q-HVVAGTPGRVFDMI-R--R-R---SLRTR--AIKMLVLDEADEML-NK-G-FKEQIYDVYRY--L----P-------PA--TQVVLISATLPHEILEMTNKFMTDPIRILVK-RD----EL----TLEGI-KQFFVAVER-E-E-W-K----F----DTLCDLYD-T----------L-TITQ-AVIFCNTKRKVDWLTEKMREA---NFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPN------NR------ELYIHRIGRSGRYGRKGVAINFV---K-NDD-IRI-LRDIEQYYS-TQIDEM-----------------------------------------------------------------------------------------------------------------
31 PsiBlast_CBE 78.6634%-130 - C1 -4BRW DHH1_YEAST A:[3-366] ---FEDFYLKRELLMGI-FEAGFEKPSPIQEEAIPVAIT--G--RDILARAKNGTGKTAAFVIPTLE----------KV---KPK------------------L---------N---K--------IQA-LIMVPTRELALQTSQVVRTLG-K-H-C----G---IS-CMVTTGGTNLRDDILRL-NET--V-HILVGTPGRVLDLA-S--R-K---VADLS--DCSLFIMDEADKML-SR-D-FKTIIEQILSF--L----P-------PT--HQSLLFSATFPLTVDEFMDKHLHKPYEINLM-EE-----L----TLKGI-TQYYAFV-E-E-R-Q-K----L----HCLNTLFS-K----------L-QINQ-AIIFCNSTNRVELLAKKITDL---GYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRGIDIQAVNVVINFDFPK------TA------ETYLHRIGRSGRFGHLGLAINLI---N-WND-RFN-LYKIEQELG-TEIAAIPA---------------------------------------------------------------------------------------------------------------
23 PsiBlast_CBE 78.2739% -73 - C1 -3EX7 IF4A3_HUMAN H:[40-403] ---FDTMGLREDLLRGI-YAYGFEKPSAIQQRAIKQIIK--G--RDVIAQSQSGTGKTATFSISVLQ----------CL---DIQ------------------V---------R---E--------TQA-LILAPTRELAVQIQKGLLALG-D-Y-M----N---VQ-CHACIGGTNVGEDIRKL-DYG--Q-HVVAGTPGRVFDMI-R--R-R---SLRTR--AIKMLVLDEADEML-NK-G-FKEQIYDVYRY--L----P-------PA--TQVVLISATLPHEILEMTNKFMTDPIRILVK-RD----EL----TLEGI-KQFFVAVER-E-E-W-K----F----DTLCDLYD-T----------L-TITQ-AVIFCNTKRKVDWLTEKMREA---NFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPN------NR------ELYIHRIGRSGRYGRKGVAINFV---K-NDD-IRI-LRDIEQYYS-TQIDEM-----------------------------------------------------------------------------------------------------------------
8 PsiBlast_PDB 78.0439% -77 - C1 -2J0U IF4A3_HUMAN A:[3-366] ---FDTMGLREDLLRGI-YAYGFEKPSAIQQRAIKQIIK--G--RDVIAQSQSGTGKTATFSVSVLQ----------CL---DIQ------------------V---------R---E--------TQA-LILAPTRELAVQVQKGLLALG-D-Y-M----N---VQ-CHACIGGTNVGEDIRKL-DYG--Q-HVVAGTPGRVFDMI-R--R-R---SLRTR--AIKMLVLDEADEML-NK-G-FKEQIYDVYRY--L----P-------PA--TQVVLISATLPHEILEMTNKFMTDPIRILVK-RD----EL----TLEGI-KQFFVAVER-E-E-W-K----F----DTLCDLYD---------------ITQ-AVIFCNTKRKVDWLTEKMREA---NFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWAR--DVPQVSLIINYDLPN------NR------ELYIHRIGRSGRYGRKGVAVNFV---K-NDD-IRV-LRDIEQYYS-TQIDEM-----------------------------------------------------------------------------------------------------------------
25 PsiBlast_CBE 76.8742% -18 - C1 -4KBG ? B:[3-364] ---FKDFPLKPEILEAL-HGRGLTTPTPIQAAALPLALE--G--KDLIGQARTGTGKTLAFALPIAER---------LA---PSQ------------------ERG-------R---K--------PRA-LVLTPTRELALQVASELTAVA-----P----H---LK-VVAVYGGTGYGKQKEAL-LRG--A-DAVVATPGRALDYL-R--Q-G---VLDLS--RVEVAVLDEADEML-SM-G-FEEEVEALLSA--T----P-------PS--RQTLLFSATLPSWAKRLAERYMKNPVLINVI-KD----EP----VTYEE-EAVPAPV-R-----G-R----L----EVLSDLLY-V----------A-SPDR-AMVFTRTKAETEEIAQGLLRL---GHPAQALHGDLSQGERERVLGAFRQGEVRVLVATDVAARGLDIPQVDLVVHYRLPD------RA------EAYQHRSGRTGRAGRGGRVVLLY---G-PRE-RRD-VEALERAVG-RRFKRV-----------------------------------------------------------------------------------------------------------------
7 PsiBlast_PDB 76.5539% -82 - C1 -2HXY - IF4A3_HUMAN A:[40-403] ---FDTMGLREDLLRGI-YAYGFEKPSAIQQRAIKQIIK--G--RDVIAQSQSGTGKTATFSISVLQ----------CL---DIQ------------------V---------R---E--------TQA-LILAPTRELAVQIQKGLLALG-D-Y-M----N---VQ-CHACIGGTNVGEDIRKL-DYG--Q-HVVAGTPGRVFDMI-R--R-R---SLRTR--AIKMLVLDEADEML-NK-G-FKEQIYDVYRY--L----P-------PA--TQVVLISATLPHEILEMTNKFMTDPIRILVK-RD----EL----TLEGI-KQFFVAVER-E-E-W-K----F----DTLCDLYD-T----------L-TITQ-AVIFCNTKRKVDWLTEKMREA---NFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPN------NR------ELYIHRIGRSGRYGRKGVAINFV---K-NDD-IRI-LRDIEQYYS-TQIDEM-----------------------------------------------------------------------------------------------------------------
19 PsiBlast_PDB 76.2035% -40 - C1 -4CT4 DDX6_HUMAN B:[7-371] ---FEDYCLKRELLMGI-FEMGWEKPSPIQEESIPIALS--G--RDILARAKNGTGKSGAYLIPLLE----------RL---DLK------------------K---------D---N--------IQA-MVIVPTRELALQVSQICIQVS-KHM-G----G---AK-VMATTGGTNLRDDIMRL-DDT--V-HVVIATPGRILDLI-K--K-G---VAKVD--HVQMIVLDEADKLL-SQ-D-FVQIMEDIILT--L----P-------KN--RQILLYSATFPLSVQKFMNSHLQKPYEINLM-EE-----L----TLKGV-TQYYAYV-T-E-R-Q-K----V----HCLNTLFS-R----------L-QINQ-SIIFCNSSQRVELLAKKISQL---GYSCFYIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPK------LA------ETYLHRIGRSGRFGHLGLAINLI---T--YD-DRFNLKSIEEQLG-TEIKPIPS---------------------------------------------------------------------------------------------------------------
10 PsiBlast_PDB 75.9542% -16 - C1 -4KBF ? A:[3-364] ---FKDFPLKPEILEAL-HGRGLTTPTPIQAAALPLALE--G--KDLIGQARTGTGKTLAFALPIAER---------LA---PSQ------------------ERG-------R---K--------PRA-LVLTPTRELALQVASELTAVA-----P----H---LK-VVAVYGGTGYGKQKEAL-LRG--A-DAVVATPGRALDYL-R--Q-G---VLDLS--RVEVAVLDEADEML-SM-G-FEEEVEALLSA--T----P-------PS--RQTLLFSATLPSWAKRLAERYMKNPVLINVI-KD----EP----VTYEE-EAVPAPV-R-----G-R----L----EVLSDLLY-V----------A-SPDR-AMVFTRTKAETEEIAQGLLRL---GHPAQALHGDLSQGERERVLGAFRQGEVRVLVATDVAARGLDIPQVDLVVHYRLPD------RA------EAYQHRSGRTGRAGRGGRVVLLY---G-PRE-RRD-VEALERAVG-RRFKRV-----------------------------------------------------------------------------------------------------------------
131 HHSearch 74.9742% -15 - C1 -4KBF ? A:[1-362] -MEFKDFPLKPEILEAL-HGRGLTTPTPIQAAALPLALE--G--KDLIGQARTGTGKTLAFALPIAE----------RL---APSQER---------------G---------R---K--------PRA-LVLTPTRELALQVASELTAVA-P-H----------LK-VVAVYGGTGYGKQKEAL-LRG--A-DAVVATPGRALDYL-R--Q-G---VLDLS--RVEVAVLDEADEML-SM-G-FEEEVEALLSA--T----P-------PS--RQTLLFSATLPSWAKRLAERYMKNPVLINVI-KD----EP----VT--Y-EEEAVPA-P-V-R-G-R----L----EVLSDLLY-V----------A-SPDR-AMVFTRTKAETEEIAQGLLRL---GHPAQALHGDLSQGERERVLGAFRQGEVRVLVATDVAARGLDIPQVDLVVHYRLPD------RA------EAYQHRSGRTGRAGRGGRVVLLY---G-PRE-RRD-VEALERAVG-RRFK-------------------------------------------------------------------------------------------------------------------
118 HHSearch 74.8040% -2 - C1 -4PXA DDX3X_HUMAN A:[65-445] -ESFSDVEMGEIIMGNI-ELTRYTRPTPVQKHAIPIIKE--K--RDLMACAQTGSGKTAAFLLPILS----------QI---YSDGPGEALRAMKENGRYGRRK---------Q---Y--------PIS-LVLAPTRELAVQIYEEARKFS-Y-R-S----R---VR-PCVVYGGADIGQQIRDL-ERG--C-HLLVATPGRLVDMM-E--R-G---KIGLD--FCKYLVLDEADRML-VM-G-FEPQIRRIVEQ--D----TMPPK---GV--RHTMMFSATFPKEIQMLARDFLDEYIFLAVG-RV----GS----TSENI-TQKVVWV-E-E-S-D-K----R----SFLLDLLN-A----------TGKDSL-TLVFVETKKGADSLEDFLYHE---GYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPS------DI------EEYVHRIGRTGRVGNLGLATSFF---N-ERN-INI-TKDLLDLL-------------------------------------------------------------------------------------------------------------------------
135 HHSearch 74.4240% 13 - C1 -2I4I DDX3X_HUMAN A:[15-391] -ESFSDVEMGEIIMGNI-ELTRYTRPTPVQKHAIPIIKE--K--RDLMACAQTGSGKTAAFLLPILS----------QI---YSDGPGEALRAMKENGRYGRRK---------Q---Y--------PIS-LVLAPTRELAVQIYEEARKFS-Y-R-S----R---VR-PCVVYGGADIGQQIRDL-ERG--C-HLLVATPGRLVDMM-E--R-G---KIGLD--FCKYLVLDEADRML-DM-G-FEPQIRRIVEQ--DTMPPK-------GV--RHTMMFSATFPKEIQMLARDFLDEYIFLAVG-------------TSENI-TQKVVWV-E-E-S-D-K----R----SFLLDLLN-AT---------G-KDSL-TLVFVETKKGADSLEDFLYHE---GYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPS------DI------EEYVHRIGRTGR--NLGLATSFF---N-ERN-INI-TKDL-----------------------------------------------------------------------------------------------------------------------------
16 PsiBlast_PDB 73.2140% -7 - C1 -4PXA DDX3X_HUMAN A:[67-429] ---FSDVEMGEIIMGNI-ELTRYTRPTPVQKHAIPIIKE--K--RDLMACAQTGSGKTAAFLLPILSQIYSDGPGEALR---AMK------------------E---------N---GRYGRRKQYPIS-LVLAPTRELAVQIYEEARKFS-Y-R-S----R---VR-PCVVYGGADIGQQIRDL-ERG--C-HLLVATPGRLVDMM-E--R-G---KIGLD--FCKYLVLDEADRML-VM-G-FEPQIRRIVEQDTM----P-------PKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVG-RV----GS----TSENI-TQKVVWV-E-E-S-D-K----R----SFLLDLLN-A----------T-GKDSLTLVFVETKKGADSLEDFLYHE---GYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPS------DI------EEYVHRIGRTGRVGNLGLATSF-----------------------------------------------------------------------------------------------------------------------------------------------
12 PsiBlast_PDB 72.4840% 13 - C1 -2I4I DDX3X_HUMAN A:[17-379] ---FSDVEMGEIIMGNI-ELTRYTRPTPVQKHAIPIIKE--K--RDLMACAQTGSGKTAAFLLPILSQIYSDGPGEALR---AMK------------------E---------N---GRYGRRKQYPIS-LVLAPTRELAVQIYEEARKFS-Y-R-S----R---VR-PCVVYGGADIGQQIRDL-ERG--C-HLLVATPGRLVDMM-E--R-G---KIGLD--FCKYLVLDEADRML-DM-G-FEPQIRRIVEQDTM----P-------PKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVG-------------TSENI-TQKVVWV-E-E-S-D-K----R----SFLLDLLN-A----------T-GKDSLTLVFVETKKGADSLEDFLYHE---GYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPS------DI------EEYVHRIGRTGR--NLGLATSF-----------------------------------------------------------------------------------------------------------------------------------------------
14 PsiBlast_PDB 72.3840% 8 - C1 -5E7J DDX3X_HUMAN A:[50-412] ---FSDVEMGEIIMGNI-ELTRYTRPTPVQKHAIPIIKE--K--RDLMACAQTGSGKTAAFLLPILSQIYSDGPGEALR---AMK---------------------------------KQY-----PIS-LVLAPTRELAVQIYEEARKFS-Y-R-S----R---VR-PCVVYGGADIGQQIRDL-ERG--C-HLLVATPGRLVDMM-E--R-G---KIGLD--FCKYLVLDEADRML-DM-G-FEPQIRRIVEQDTM----P-------PKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVG-RV----GS----TSENI-TQKVVWV-E-E-S-D-K----R----SFLLDLLN-A----------T-GKDSLTLVFVETKKGADSLEDFLYHE---GYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPS------DI------EEYVHRIGRTGRVGNLGLATSF-----------------------------------------------------------------------------------------------------------------------------------------------