@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu40250: (2016-08-07 )
MGGMALTGNKAVVYKGKGTVAVEDIGYPELILRDGPGVPKANVNRKCEHGVILKVITTNICGSDQHMVRGRTTAPEGLVLGHEITGEVIETGRDVEFIKKGDIVSVPFNIACGRCVMCKTQKTHVCLNVNPDRPGSAYGYVDMGGWVGGQSEYVMVPYADFQLLVFPDKEQALEKILDLTMLSDIFPTGFHGAYTAGVQTGSTVYIAGAGPVGLAAAHSAQLLGASTVIVGDLNEDRLAQARSFGCETVNVQKHDRLGEQIEQILGEPTVDAAVDCVGFEASGHGNQGEAPAAVLNSIMDVTQVGGSLGIPGLYVTEDPGAKDADAKTGSLKIRFGLGWAKAHTFVTGQTPAMTYNRNLMKAILSGRAQIAKAVNATVISLDDAPKGYSDFDKGAAKKFVIDPHGTLK

Atome Classification :

(25 SA) .........10.......-.-20........30........40........50--........60...-...------..70-..---------......80........90........100.......110.......120.....----.---.130.-------.-------------------..---------------.--------------..140-...---------..----....150.........--160.......170...----...----.180.......190..-.-....200.......-210.......220.......230.......240....-...250...-....260...--....---270.......280--...--....---.290-.........300..-.-....310.......320.......330.......340......-.--350-.--.--.......360.....-..370...-....380.......390..-.....400......-
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MGGMALTGNKAVVYKGKG-T-VAVEDIGYPELILRDGPGVPKANVNRKCEHGV--ILKVITTNICGSD-QHM------VRGR-TT---------APEGLVLGHEITGEVIETGRDVEFIKKGDIVSVPFNIACGRCVMCKTQKTHVCL----N---VNPDR-------P-------------------GS---------------A--------------YGY---VDM---------GG----WVGGQ--SEYVMVPYA--DFQLLVFPDKEQALEK----ILD----LTMLSDIFPTGFHGAY-T-AGVQTGSTVYIAGA-GPVGLAAAHSAQLLGASTVIVGDLNEDRLAQARSFGC-ETVNVQKHD-RLGEQIEQIL--GEPT---VDAAVDCVGFEA---SGH--GNQG---EA---PAAVLNSIMDVTQV-G-GSLGIPGLYVTEDPGAKDADAKTGSLKIRFGLGWAKAHTFVTG-Q--T---P--A--MTYNRNLMKAILSGR-AQIAKAVN-ATVISLDDAPKGYSDFDKG-AAKKFVIDPHGTLK-
23 PsiBlast_CBE 98.1566% -83 - C1 -4JLW ? B:[3-397] -------GNRGVVYLGPG-K-VEVQNIPYPKM--QDPQG-------RQIDHGV--ILRVVSTNICGSD-QHM------VRGR-TT---------APEGLVLGHEITGEVVEIGRGVETMKIGDLVSVPFNVACGHCRTCKEQHTGVCL----T---VNPAR-------A-------------------GG---------------A--------------YGY---VDM---------GG----WVGGQ--AEYVLVPYA--DFNLLKLPNREAAMEK----IRD----LTCLSDILPTGYHGAV-T-AGVGPGSTVYIAGA-GPVGLAAAASARLLGAAVVIVGDVNPTRLAHAKKQGF-EIADLSKDT-PLHEQIAALL--GEPE---VDCAVDAVGFEA---RGH--GHSGSQQEA---PATVLNSLMGITRV-A-GKIGIPGLYVTEDPGAVDAAAKHGALSIRFGLGWAKSHSFHTG-Q--T---P--V--MKYNRQLMQAIMWDR-IKIADIVG-VEVITLDDAPKGYGEFDAG-VPKKFVIDPHNLFR-
22 PsiBlast_CBE 98.0766% -84 - C1 -4JLW ? C:[3-397] -------GNRGVVYLGPG-K-VEVQNIPYPKM--QDPQG-------RQIDHGV--ILRVVSTNICGSD-QHM------VRGR-TT---------APEGLVLGHEITGEVVEIGRGVETMKIGDLVSVPFNVACGHCRTCKEQHTGVCL----T---VNPAR-------A-------------------GG---------------A--------------YGY---VDM---------GG----WVGGQ--AEYVLVPYA--DFNLLKLPNREAAMEK----IRD----LTCLSDILPTGYHGAV-T-AGVGPGSTVYIAGA-GPVGLAAAASARLLGAAVVIVGDVNPTRLAHAKKQGF-EIADLSKDT-PLHEQIAALL--GEPE---VDCAVDAVGFEA---RGH--GHSGSQQEA---PATVLNSLMGITRV-A-GKIGIPGLYVTEDPGAVDAAAKHGALSIRFGLGWAKSHSFHTG-Q--T---P--V--MKYNRQLMQAIMWDR-IKIADIVG-VEVITLDDAPKGYGEFDAG-VPKKFVIDPHNLFR-
21 PsiBlast_CBE 97.9166% -83 - C1 -4JLW ? D:[3-397] -------GNRGVVYLGPG-K-VEVQNIPYPKM--QDPQG-------RQIDHGV--ILRVVSTNICGSD-QHM------VRGR-TT---------APEGLVLGHEITGEVVEIGRGVETMKIGDLVSVPFNVACGHCRTCKEQHTGVCL----T---VNPAR-------A-------------------GG---------------A--------------YGY---VDM---------GG----WVGGQ--AEYVLVPYA--DFNLLKLPNREAAMEK----IRD----LTCLSDILPTGYHGAV-T-AGVGPGSTVYIAGA-GPVGLAAAASARLLGAAVVIVGDVNPTRLAHAKKQGF-EIADLSKDT-PLHEQIAALL--GEPE---VDCAVDAVGFEA---RGH--GHSGSQQEA---PATVLNSLMGITRV-A-GKIGIPGLYVTEDPGAVDAAAKHGALSIRFGLGWAKSHSFHTG-Q--T---P--V--MKYNRQLMQAIMWDR-IKIADIVG-VEVITLDDAPKGYGEFDAG-VPKKFVIDPHNLFR-
73 Fugue 97.5867% -80 - C1 -1KOL FADH_PSEPU A:[2-397] -------GNRGVVYLGSG-K-VEVQKIDYPKMQDPRGK---------KIEHGV--ILKVVSTNICGSD-QHM------VRGR-TT---------AQVGLVLGHEITGEVIEKGRDVENLQIGDLVSVPFNVACGRCRSCKEMHTGVCL----T---VNPAR-------A-------------------GG---------------A--------------YGY---VDM---------GD----WTGGQ--AEYVLVPYA--DFNLLKLPDRDKAMEK----IRD----LTCLSDILPTGYHGAV-T-AGVGPGSTVYVAGA-GPVGLAAAASARLLGAAVVIVGDLNPARLAHAKAQGF-EIADLSLDT-PLHEQIAALL--GEPE---VDCAVDAVGFEA---RGH--GHEG---AKHEAPATVLNSLMQVTRV-A-GKIGIPGLYVTEDPGAVDAAAKIGSLSIRFGLGWAKSHSFHTG-Q--T---P--V--MKYNRALMQAIMWDR-INIAEVVG-VQVISLDDAPRGYGEFDAG-VPKKFVIDPHKTFSA
24 PsiBlast_CBE 97.4966% -80 - C1 -1KOL FADH_PSEPU B:[2-395] -------GNRGVVYLGSG-K-VEVQKIDYPKM--QDPRG-------KKIEHGV--ILKVVSTNICGSD-QHM------VRGR-TT---------AQVGLVLGHEITGEVIEKGRDVENLQIGDLVSVPFNVACGRCRSCKEMHTGVCL----T---VNPAR-------A-------------------GG---------------A--------------YGY---VDM---------GD----WTGGQ--AEYVLVPYA--DFNLLKLPDRDKAMEK----IRD----LTCLSDILPTGYHGAV-T-AGVGPGSTVYVAGA-GPVGLAAAASARLLGAAVVIVGDLNPARLAHAKAQGF-EIADLSLDT-PLHEQIAALL--GEPE---VDCAVDAVGFEA---RGH--GHEGAKHEA---PATVLNSLMQVTRV-A-GKIGIPGLYVTEDPGAVDAAAKIGSLSIRFGLGWAKSHSFHTG-Q--T---P--V--MKYNRALMQAIMWDR-INIAEVVG-VQVISLDDAPRGYGEFDAG-VPKKFVIDPHKTF--
1 PsiBlast_PDB 97.4066% -82 * C1 *4JLW ? A:[3-397] -------GNRGVVYLGPG-K-VEVQNIPYPKM--QDPQG-------RQIDHGV--ILRVVSTNICGSD-QHM------VRGR-TT---------APEGLVLGHEITGEVVEIGRGVETMKIGDLVSVPFNVACGHCRTCKEQHTGVCL----T---VNPAR-------A-------------------GG---------------A--------------YGY---VDM---------GG----WVGGQ--AEYVLVPYA--DFNLLKLPNREAAMEK----IRD----LTCLSDILPTGYHGAV-T-AGVGPGSTVYIAGA-GPVGLAAAASARLLGAAVVIVGDVNPTRLAHAKKQGF-EIADLSKDT-PLHEQIAALL--GEPE---VDCAVDAVGFEA---RGH--GHSGSQQEA---PATVLNSLMGITRV-A-GKIGIPGLYVTEDPGAVDAAAKHGALSIRFGLGWAKSHSFHTG-Q--T---P--V--MKYNRQLMQAIMWDR-IKIADIVG-VEVITLDDAPKGYGEFDAG-VPKKFVIDPHNLFR-
2 PsiBlast_PDB 96.2866% -77 - C1 -1KOL FADH_PSEPU A:[2-395] -------GNRGVVYLGSG-K-VEVQKIDYPKM--QDPRG-------KKIEHGV--ILKVVSTNICGSD-QHM------VRGR-TT---------AQVGLVLGHEITGEVIEKGRDVENLQIGDLVSVPFNVACGRCRSCKEMHTGVCL----T---VNPAR-------A-------------------GG---------------A--------------YGY---VDM---------GD----WTGGQ--AEYVLVPYA--DFNLLKLPDRDKAMEK----IRD----LTCLSDILPTGYHGAV-T-AGVGPGSTVYVAGA-GPVGLAAAASARLLGAAVVIVGDLNPARLAHAKAQGF-EIADLSLDT-PLHEQIAALL--GEPE---VDCAVDAVGFEA---RGH--GHEGAKHEA---PATVLNSLMQVTRV-A-GKIGIPGLYVTEDPGAVDAAAKIGSLSIRFGLGWAKSHSFHTG-Q--T---P--V--MKYNRALMQAIMWDR-INIAEVVG-VQVISLDDAPRGYGEFDAG-VPKKFVIDPHKTF--
82 HHSearch 82.2667% -33 - C1 -1KOL FADH_PSEPU A:[2-394] -------GNRGVVYLGSG-K-VEVQKIDYPKMQD------PRGK---KIEHGV--ILKVVSTNICGSD-QHM------VRGR-TT---------AQVGLVLGHEITGEVIEKGRDVENLQIGDLVSVPFNVACGRCRSCKEMHTGVCL----T---VNPAR-------A-------------------GG---------------A--------------YGY---VDM---------GD----WTGGQ--AEYVLVPYADFN--LLKLPDR----DK----AMEKIRDLTCLSDILPTGYHGAV-T-AGVGPGSTVYVAGA-GPVGLAAAASARLLGAAVVIVGDLNPARLAHAKAQGFEIADLSLDT--PLHEQIAALL--GEPE---VDCAVDAVGFEARGHGHE--GAKH---EA---PATVLNSLMQVTRV-A-GKIGIPGLYVTEDPGAVDAAAKIGSLSIRFGLGWAKSHSFHTG-Q--T---P--V--MKYNRALMQAIMWDR-INIAEVVGVQVIS-LDDAPRGYGEFDAG-VPKKFVIDPHKT---
3 PsiBlast_PDB 79.5754% -24 - C1 -2DPH FDM_PSEPU A:[2-396] -------GNKSVVYHGTR-D-LRVETVPYPKL----------EHNNRKLEHAV--ILKVVSTNICGSD-QHI------YRGR-FI---------VPKGHVLGHEITGEVVEKGSDVELMDIGDLVSVPFNVACGRCRNCKEARSDVCE----NNL-VNPDA-------D-------------------LG---------------A--------------FGF----DL---------KG----WSGGQ--AEYVLVPYA--DYMLLKFGDKEQAMEK----IKD----LTLISDILPTGFHGCV-S-AGVKPGSHVYIAGA-GPVGRCAAAGARLLGAACVIVGDQNPERLKLLSDAGF-ETIDLRNSA-PLRDQIDQIL--GKPE---VDCGVDAVGFEA---HGL--GDEANT-ET---PNGALNSLFDVVRA-G-GAIGIPGIYVGSDPDPVNKDAGSGRLHLDFGKMWTKSIRIMTG-M--A---P--V--TNYNRHLTEAILWDQMPYLSKVMN-IEVITLDQAPDGYAKFDKG-SPAKFVIDPHGMLK-
25 PsiBlast_CBE 78.7954% -25 - C1 -2DPH FDM_PSEPU B:[2-396] -------GNKSVVYHGTR-D-LRVETVPYPKL----------EHNNRKLEHAV--ILKVVSTNICGSD-QHI------YRGR-FI---------VPKGHVLGHEITGEVVEKGSDVELMDIGDLVSVPFNVACGRCRNCKEARSDVCE----NNL-VNPDA-------D-------------------LG---------------A--------------FGF----DL---------KG----WSGGQ--AEYVLVPYA--DYMLLKFGDKEQAMEK----IKD----LTLISDILPTGFHGCV-S-AGVKPGSHVYIAGA-GPVGRCAAAGARLLGAACVIVGDQNPERLKLLSDAGF-ETIDLRNSA-PLRDQIDQIL--GKPE---VDCGVDAVGFEA---HGL--GDEANT-ET---PNGALNSLFDVVRA-G-GAIGIPGIYVGSDPDPVNKDAGSGRLHLDFGKMWTKSIRIMTG-M--A---P--V--TNYNRHLTEAILWDQMPYLSKVMN-IEVITLDQAPDGYAKFDKG-SPAKFVIDPHGMLK-
98 HHSearch 70.9952% -17 - C1 -2DPH FDM_PSEPU A:[2-395] -------GNKSVVYHGTR-D-LRVETVPYPKLE----------HNNRKLEHAV--ILKVVSTNICGSD-QHI------YRGR-FI---------VPKGHVLGHEITGEVVEKGSDVELMDIGDLVSVPFNVACGRCRNCKEARSDVCE----N---NLVNPDA-----D-------------------LG---------------A--------------FGF---D-L---------KG----WSGGQ--AEYVLVPYA--DYMLLKFGDK----EQAMEKIKD----LTLISDILPTGFHGCV-S-AGVKPGSHVYIAGA-GPVGRCAAAGARLLGAACVIVGDQNPERLKLLSDAGF-ETIDLRNSA-PLRDQIDQIL--GKPE---VDCGVDAVGFEA---HGLGDEANT---ET---PNGALNSLFDVVRA-G-GAIGIPGIYVGSDPDPVNKDAGSGRLHLDFGKMWTKSIRIMTG-M--APVTN--Y--NRHLTEAILWDQMPY-LS-KVMNI-EVIT-LDQAPDGYAKFDKG-SPAKFVIDPHGML--
89 HHSearch 59.4126% -83 - C1 -4EJ6 ? A:[21-363] -----QSMMKAVRLESVG-N-ISVRNVGIPEPG----------------PDDL--LVKVEACGICGTD-RHL------LHGE-FP---------STPPVTLGHEFCGIVVEAGSAVRDIAPGARITGDPNISCGRCPQCQAGRVNLCR----N---LRA-------------------------------------------------------------IGI----------------H----RDGGF--AEYVLVPRK--Q--AFEIPLT----LD----PVH----GAFC-EPLACCLHGVD-L-SGIKAGSTVAILGG-GVIGLLTVQLARLAGATTVILSTRQATKRRLAEEVGATATVDPSAG--DVVEAIAGPVGLVPGG---VDVVIECAGVA-----------------------ETVKQSTRLAKA-G-GTVVILGVLPQGE-----------KVEIEPFDILFRELRVLGS-F--I------N--PFVHRRAADLVATGA-IEIDRMIS-RRIS-LDEAPDVISNPAAA-GEVKVLVIPS-----
4 PsiBlast_PDB 57.4029% -40 - C1 -4CPD ? A:[2-343] ---------RAVVFENKE-R-VAVKEVNAPRL-----------------QHPLDALVRVHLAGICGSD-LHL------YHGK-IP---------VLPGSVLGHEFVGQVEAVGEGIQDLQPGDWVVGPFHIACGTCPYCRRHQYNLC------------ER---------------------------GG---------------V--------------YGY---GPMF--------GN----LQGAQ--AEILRVPFS--NVNLRKLPPNLSPERA----IFA--------GDILSTAYGGLI-Q-GQLRPGDSVAVIGA-GPVGLMAIEVAQVLGASKILAIDRIPERLERAASLGA-IPINAEQEN-----PVRRVR--SE-T---NDEGPDLV-LEA---VGG---------------AATLSLALEMVRP-G-GRVSAVG--VDNAP----------SFPFPLASGLVKDLTFRIG-L--A---N--V--HLYIDAVLALLASGR-LQPERIV--SHYLPLEEAPRGYELFDRK-EALKVLL--------
87 HHSearch 47.6025% -40 - C1 -1E3I ADH4_MOUSE A:[4-367] ---GKVIKCKAAIAWKTG-SPLCIEEIEVSPPK----------------ACEV--RIQVIATCVCPTD-INA------TDPK-KK---------ALFPVVLGHECAGIVESVGPGVTNFKPGDKVIPFFAPQCKRCKLCLSPLTNLCG----K---LRNFK-------YPTIDQELMEDRTSRFTCKGRS---------------I--------------YHF----------------M----GVSSF--SQYTVVSEA--N--LARVDDE----AN----LER----VCLIGCGFSSGYGAAI-NTAKVTPGSTCAVFGL-GCVGLSAIIGCKIAGASRIIAIDINGEKFPKAKALGATDCLNPRELDKPVQDVITELT--A-GG---VDYSLDCAGTA-----------------------QTLKAAVDCTVL-GWGSCTVVGAKVDE-------------MTIPTVDVI-LGRSINGTFFGGW---K--S--VDSVPNLVSDYKNKK-FDLDLLVT-HALP-FESINDAIDLMKEG----------------
77 Fugue 46.1825% -38 - C1 -1TEH ADHX_HUMAN A:[1-373] -ANEVIKCKAAVAWEAGK-P-LSIEEIEVAP---------PKA-------HEV--RIKIIATAVCHTD-AYT------LSGADPE---------GCFPVILGHEGAGIVESVGEGVTKLKAGDTVIPLYIPQCGECKFCLNPKTNLCQ----K---IRVTQ-------G-------------------KGLMPDGTSRF------T--------------CKG---KTI---------LH----YMGTSTFSEYTVVADI--S---VAKIDPLAPLDK----VCL----LGC---GISTGYGAAVNT-AKLEPGSVCAVFGL-GGVGLAVIMGCKVAGASRIIGVDINKDKFARAKEFGATECINPQDFS-KPIQEVLIEM--TDGG---VDYSFECIG-----------------------NVKVMRAALEACHK-G-W-----GVSVVVGVAASGEEIATRPFQLVTGRTWKGTAF---G-G--W---K--S--VESVPKLVSEYMSKK-IKVDEFVT-HNLS-FDEINKAFELMHSG-KSIRTVVKI------