@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu40320: (2016-08-07 )
MDKTISVIGMPMDLGQARRGVDMGPSAIRYAHLIERLSDMGYTVEDLGDIPINREKIKNDEELKNLNSVLAGNEKLAQKVNKVIEEKKFPLVLGGDHSIAIGTLAGTAKHYDNLGVIWYDAHGDLNTLETSPSGNIHGMPLAVSLGIGHESLVNLEGYAPKIKPENVVIIGARSLDEGERKYIKESGMKVYTMHEIDRLGMTKVIEETLDYLSACDGVHLSLDLDGLDPNDAPGVGTPVVGGISYRESHLAMEMLYDAGIITSAEFVEVNPILDHKNKTGKTAVELVESLLGKKLL

Atome Classification :

(74 SA) .........10........20........30........40-----........50...-..--.--..--60..---......70........80........90........100.......110.......120.......130.......140.......150..---.---.-...---160.......170.......180.......190.......200.......210--.--......220.......230.......240.......250.......260.......270.----...----..-----------.280.......290....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MDKTISVIGMPMDLGQARRGVDMGPSAIRYAHLIERLSDMG-----YTVEDLGDIPINR-EK--I--KN--DEEL---KNLNSVLAGNEKLAQKVNKVIEEKKFPLVLGGDHSIAIGTLAGTAKHYDNLGVIWYDAHGDLNTLETSPSGNIHGMPLAVSLGIGHESLVN---L---E-GYA---PKIKPENVVIIGARSLDEGERKYIKESGMKVYTMHEIDRLGMTKVIEETLDYL--S--ACDGVHLSLDLDGLDPNDAPGVGTPVVGGISYRESHLAMEMLYDAGIITSAEFVEVNPIL----DHK----NK-----------TGKTAVELVESLLGKKLL
44 PsiBlast_CBE 87.0270% -14 - C7 -1CEV ARGI_BACCD C:[2-299] --KPISIIGVPMDLGQTRRGVDMGPSAMRYAGVIERLERLH-----YDIEDLGDIPIGKAER--LHEQG--DSRL---RNLKAVAEANEKLAAAVDQVVQRGRFPLVLGGDHSIAIGTLAGVAKHYERLGVIWYDAHGDVNTAETSPSGNIHGMPLAASLGFGHPALTQ---I---G-GYS---PKIKPEHVVLIGVRSLDEGEKKFIREKGIKIYTMHEVDRLGMTRVMEETIAYL--KE-RTDGVHLSLDLDGLDPSDAPGVGTPVIGGLTYRESHLAMEMLAEAQIITSAEFVEVNPIL----DER----NK-----------TASVAVALMGSLFGEKLM
1 PsiBlast_PDB 86.8970% -13 - C7 -1CEV ARGI_BACCD A:[2-299] --KPISIIGVPMDLGQTRRGVDMGPSAMRYAGVIERLERLH-----YDIEDLGDIPIGKAER--LHEQG--DSRL---RNLKAVAEANEKLAAAVDQVVQRGRFPLVLGGDHSIAIGTLAGVAKHYERLGVIWYDAHGDVNTAETSPSGNIHGMPLAASLGFGHPALTQ---I---G-GYS---PKIKPEHVVLIGVRSLDEGEKKFIREKGIKIYTMHEVDRLGMTRVMEETIAYL--KE-RTDGVHLSLDLDGLDPSDAPGVGTPVIGGLTYRESHLAMEMLAEAQIITSAEFVEVNPIL----DER----NK-----------TASVAVALMGSLFGEKLM
39 PsiBlast_CBE 86.6970% -12 - C7 -2CEV ARGI_BACCD C:[2-299] --KPISIIGVPMDLGQTRRGVDMGPSAMRYAGVIERLERLH-----YDIEDLGDIPIGKAER--LHEQG--DSRL---RNLKAVAEANEKLAAAVDQVVQRGRFPLVLGGDHSIAIGTLAGVAKHYERLGVIWYDAHGDVNTAETSPSGNIHGMPLAASLGFGHPALTQ---I---G-GYS---PKIKPEHVVLIGVRSLDEGEKKFIREKGIKIYTMHEVDRLGMTRVMEETIAYL--KE-RTDGVHLSLDLDGLDPSDAPGVGTPVIGGLTYRESHLAMEMLAEAQIITSAEFVEVNPIL----DER----NK-----------TASVAVALMGSLFGEKLM
24 PsiBlast_CBE 86.6770% -11 - C7 -5CEV ARGI_BACCD C:[2-299] --KPISIIGVPMDLGQTRRGVDMGPSAMRYAGVIERLERLH-----YDIEDLGDIPIGKAER--LHEQG--DSRL---RNLKAVAEANEKLAAAVDQVVQRGRFPLVLGGDHSIAIGTLAGVAKHYERLGVIWYDAHGDVNTAETSPSGNIHGMPLAASLGFGHPALTQ---I---G-GYS---PKIKPEHVVLIGVRSLDEGEKKFIREKGIKIYTMHEVDRLGMTRVMEETIAYL--KE-RTDGVHLSLDLDGLDPSDAPGVGTPVIGGLTYRESHLAMEMLAEAQIITSAEFVEVNPIL----DER----NK-----------TASVAVALMGSLFGEKLM
37 PsiBlast_CBE 86.6670% -11 - C7 -2CEV ARGI_BACCD E:[2-299] --KPISIIGVPMDLGQTRRGVDMGPSAMRYAGVIERLERLH-----YDIEDLGDIPIGKAER--LHEQG--DSRL---RNLKAVAEANEKLAAAVDQVVQRGRFPLVLGGDHSIAIGTLAGVAKHYERLGVIWYDAHGDVNTAETSPSGNIHGMPLAASLGFGHPALTQ---I---G-GYS---PKIKPEHVVLIGVRSLDEGEKKFIREKGIKIYTMHEVDRLGMTRVMEETIAYL--KE-RTDGVHLSLDLDGLDPSDAPGVGTPVIGGLTYRESHLAMEMLAEAQIITSAEFVEVNPIL----DER----NK-----------TASVAVALMGSLFGEKLM
34 PsiBlast_CBE 86.5270% -11 - C7 -3CEV ARGI_BACCD C:[2-299] --KPISIIGVPMDLGQTRRGVDMGPSAMRYAGVIERLERLH-----YDIEDLGDIPIGKAER--LHEQG--DSRL---RNLKAVAEANEKLAAAVDQVVQRGRFPLVLGGDHSIAIGTLAGVAKHYERLGVIWYDAHGDVNTAETSPSGNIHGMPLAASLGFGHPALTQ---I---G-GYS---PKIKPEHVVLIGVRSLDEGEKKFIREKGIKIYTMHEVDRLGMTRVMEETIAYL--KE-RTDGVHLSLDLDGLDPSDAPGVGTPVIGGLTYRESHLAMEMLAEAQIITSAEFVEVNPIL----DER----NK-----------TASVAVALMGSLFGEKLM
3 PsiBlast_PDB 86.5070% -11 - C7 -3CEV ARGI_BACCD A:[2-299] --KPISIIGVPMDLGQTRRGVDMGPSAMRYAGVIERLERLH-----YDIEDLGDIPIGKAER--LHEQG--DSRL---RNLKAVAEANEKLAAAVDQVVQRGRFPLVLGGDHSIAIGTLAGVAKHYERLGVIWYDAHGDVNTAETSPSGNIHGMPLAASLGFGHPALTQ---I---G-GYS---PKIKPEHVVLIGVRSLDEGEKKFIREKGIKIYTMHEVDRLGMTRVMEETIAYL--KE-RTDGVHLSLDLDGLDPSDAPGVGTPVIGGLTYRESHLAMEMLAEAQIITSAEFVEVNPIL----DER----NK-----------TASVAVALMGSLFGEKLM
36 PsiBlast_CBE 86.4870% -10 - C7 -2CEV ARGI_BACCD F:[2-299] --KPISIIGVPMDLGQTRRGVDMGPSAMRYAGVIERLERLH-----YDIEDLGDIPIGKAER--LHEQG--DSRL---RNLKAVAEANEKLAAAVDQVVQRGRFPLVLGGDHSIAIGTLAGVAKHYERLGVIWYDAHGDVNTAETSPSGNIHGMPLAASLGFGHPALTQ---I---G-GYS---PKIKPEHVVLIGVRSLDEGEKKFIREKGIKIYTMHEVDRLGMTRVMEETIAYL--KE-RTDGVHLSLDLDGLDPSDAPGVGTPVIGGLTYRESHLAMEMLAEAQIITSAEFVEVNPIL----DER----NK-----------TASVAVALMGSLFGEKLM
33 PsiBlast_CBE 86.4870% -9 - C7 -3CEV ARGI_BACCD D:[2-299] --KPISIIGVPMDLGQTRRGVDMGPSAMRYAGVIERLERLH-----YDIEDLGDIPIGKAER--LHEQG--DSRL---RNLKAVAEANEKLAAAVDQVVQRGRFPLVLGGDHSIAIGTLAGVAKHYERLGVIWYDAHGDVNTAETSPSGNIHGMPLAASLGFGHPALTQ---I---G-GYS---PKIKPEHVVLIGVRSLDEGEKKFIREKGIKIYTMHEVDRLGMTRVMEETIAYL--KE-RTDGVHLSLDLDGLDPSDAPGVGTPVIGGLTYRESHLAMEMLAEAQIITSAEFVEVNPIL----DER----NK-----------TASVAVALMGSLFGEKLM
41 PsiBlast_CBE 86.4570% -13 - C7 -1CEV ARGI_BACCD F:[2-299] --KPISIIGVPMDLGQTRRGVDMGPSAMRYAGVIERLERLH-----YDIEDLGDIPIGKAER--LHEQG--DSRL---RNLKAVAEANEKLAAAVDQVVQRGRFPLVLGGDHSIAIGTLAGVAKHYERLGVIWYDAHGDVNTAETSPSGNIHGMPLAASLGFGHPALTQ---I---G-GYS---PKIKPEHVVLIGVRSLDEGEKKFIREKGIKIYTMHEVDRLGMTRVMEETIAYL--KE-RTDGVHLSLDLDGLDPSDAPGVGTPVIGGLTYRESHLAMEMLAEAQIITSAEFVEVNPIL----DER----NK-----------TASVAVALMGSLFGEKLM
42 PsiBlast_CBE 86.4270% -15 - C7 -1CEV ARGI_BACCD E:[2-299] --KPISIIGVPMDLGQTRRGVDMGPSAMRYAGVIERLERLH-----YDIEDLGDIPIGKAER--LHEQG--DSRL---RNLKAVAEANEKLAAAVDQVVQRGRFPLVLGGDHSIAIGTLAGVAKHYERLGVIWYDAHGDVNTAETSPSGNIHGMPLAASLGFGHPALTQ---I---G-GYS---PKIKPEHVVLIGVRSLDEGEKKFIREKGIKIYTMHEVDRLGMTRVMEETIAYL--KE-RTDGVHLSLDLDGLDPSDAPGVGTPVIGGLTYRESHLAMEMLAEAQIITSAEFVEVNPIL----DER----NK-----------TASVAVALMGSLFGEKLM
31 PsiBlast_CBE 86.3670% -12 - C7 -3CEV ARGI_BACCD F:[2-299] --KPISIIGVPMDLGQTRRGVDMGPSAMRYAGVIERLERLH-----YDIEDLGDIPIGKAER--LHEQG--DSRL---RNLKAVAEANEKLAAAVDQVVQRGRFPLVLGGDHSIAIGTLAGVAKHYERLGVIWYDAHGDVNTAETSPSGNIHGMPLAASLGFGHPALTQ---I---G-GYS---PKIKPEHVVLIGVRSLDEGEKKFIREKGIKIYTMHEVDRLGMTRVMEETIAYL--KE-RTDGVHLSLDLDGLDPSDAPGVGTPVIGGLTYRESHLAMEMLAEAQIITSAEFVEVNPIL----DER----NK-----------TASVAVALMGSLFGEKLM
45 PsiBlast_CBE 86.3270% -13 - C7 -1CEV ARGI_BACCD B:[2-299] --KPISIIGVPMDLGQTRRGVDMGPSAMRYAGVIERLERLH-----YDIEDLGDIPIGKAER--LHEQG--DSRL---RNLKAVAEANEKLAAAVDQVVQRGRFPLVLGGDHSIAIGTLAGVAKHYERLGVIWYDAHGDVNTAETSPSGNIHGMPLAASLGFGHPALTQ---I---G-GYS---PKIKPEHVVLIGVRSLDEGEKKFIREKGIKIYTMHEVDRLGMTRVMEETIAYL--KE-RTDGVHLSLDLDGLDPSDAPGVGTPVIGGLTYRESHLAMEMLAEAQIITSAEFVEVNPIL----DER----NK-----------TASVAVALMGSLFGEKLM
40 PsiBlast_CBE 86.3270% -14 - C7 -2CEV ARGI_BACCD B:[2-299] --KPISIIGVPMDLGQTRRGVDMGPSAMRYAGVIERLERLH-----YDIEDLGDIPIGKAER--LHEQG--DSRL---RNLKAVAEANEKLAAAVDQVVQRGRFPLVLGGDHSIAIGTLAGVAKHYERLGVIWYDAHGDVNTAETSPSGNIHGMPLAASLGFGHPALTQ---I---G-GYS---PKIKPEHVVLIGVRSLDEGEKKFIREKGIKIYTMHEVDRLGMTRVMEETIAYL--KE-RTDGVHLSLDLDGLDPSDAPGVGTPVIGGLTYRESHLAMEMLAEAQIITSAEFVEVNPIL----DER----NK-----------TASVAVALMGSLFGEKLM
43 PsiBlast_CBE 86.2970% -13 - C7 -1CEV ARGI_BACCD D:[2-299] --KPISIIGVPMDLGQTRRGVDMGPSAMRYAGVIERLERLH-----YDIEDLGDIPIGKAER--LHEQG--DSRL---RNLKAVAEANEKLAAAVDQVVQRGRFPLVLGGDHSIAIGTLAGVAKHYERLGVIWYDAHGDVNTAETSPSGNIHGMPLAASLGFGHPALTQ---I---G-GYS---PKIKPEHVVLIGVRSLDEGEKKFIREKGIKIYTMHEVDRLGMTRVMEETIAYL--KE-RTDGVHLSLDLDGLDPSDAPGVGTPVIGGLTYRESHLAMEMLAEAQIITSAEFVEVNPIL----DER----NK-----------TASVAVALMGSLFGEKLM
32 PsiBlast_CBE 86.2870% -12 - C7 -3CEV ARGI_BACCD E:[2-299] --KPISIIGVPMDLGQTRRGVDMGPSAMRYAGVIERLERLH-----YDIEDLGDIPIGKAER--LHEQG--DSRL---RNLKAVAEANEKLAAAVDQVVQRGRFPLVLGGDHSIAIGTLAGVAKHYERLGVIWYDAHGDVNTAETSPSGNIHGMPLAASLGFGHPALTQ---I---G-GYS---PKIKPEHVVLIGVRSLDEGEKKFIREKGIKIYTMHEVDRLGMTRVMEETIAYL--KE-RTDGVHLSLDLDGLDPSDAPGVGTPVIGGLTYRESHLAMEMLAEAQIITSAEFVEVNPIL----DER----NK-----------TASVAVALMGSLFGEKLM
21 PsiBlast_CBE 86.1570% -11 - C7 -5CEV ARGI_BACCD F:[2-299] --KPISIIGVPMDLGQTRRGVDMGPSAMRYAGVIERLERLH-----YDIEDLGDIPIGKAER--LHEQG--DSRL---RNLKAVAEANEKLAAAVDQVVQRGRFPLVLGGDHSIAIGTLAGVAKHYERLGVIWYDAHGDVNTAETSPSGNIHGMPLAASLGFGHPALTQ---I---G-GYS---PKIKPEHVVLIGVRSLDEGEKKFIREKGIKIYTMHEVDRLGMTRVMEETIAYL--KE-RTDGVHLSLDLDGLDPSDAPGVGTPVIGGLTYRESHLAMEMLAEAQIITSAEFVEVNPIL----DER----NK-----------TASVAVALMGSLFGEKLM
29 PsiBlast_CBE 86.1070% -11 - C7 -4CEV ARGI_BACCD C:[2-299] --KPISIIGVPMDLGQTRRGVDMGPSAMRYAGVIERLERLH-----YDIEDLGDIPIGKAER--LHEQG--DSRL---RNLKAVAEANEKLAAAVDQVVQRGRFPLVLGGDHSIAIGTLAGVAKHYERLGVIWYDAHGDVNTAETSPSGNIHGMPLAASLGFGHPALTQ---I---G-GYS---PKIKPEHVVLIGVRSLDEGEKKFIREKGIKIYTMHEVDRLGMTRVMEETIAYL--KE-RTDGVHLSLDLDGLDPSDAPGVGTPVIGGLTYRESHLAMEMLAEAQIITSAEFVEVNPIL----DER----NK-----------TASVAVALMGSLFGEKLM
106 HHSearch 86.0653%-116 - C7 -2EF5 ? A:[2-290] ---RVAVVGVPMDLG-----VDMGPSALRYARLLEQLEDLG-----YTVEDLGDVPVSL-A------------------YLEEIRAAALVLKERLAA-LPEGVFPIVLGGDHSLSMGSVAGAARG-RRVGVVWVDAHADFNTPETS-SGNVHGMPLAVLSGLGHPRLTE---V-------F---RAVDPKDVVLVGVRSLDPGEKRLLKEAGVRVYTMHEVDRLGVARIAEEVLKHL-----QGLPLHVSLDADVLDPTLAPGVGTPVPGGLTYREAHLLMEILAESGRVQSLDLVEVNPIL----DER----NR-----------TAEMLVGLALSLLGKRIF
27 PsiBlast_CBE 86.0270% -12 - C7 -4CEV ARGI_BACCD E:[2-299] --KPISIIGVPMDLGQTRRGVDMGPSAMRYAGVIERLERLH-----YDIEDLGDIPIGKAER--LHEQG--DSRL---RNLKAVAEANEKLAAAVDQVVQRGRFPLVLGGDHSIAIGTLAGVAKHYERLGVIWYDAHGDVNTAETSPSGNIHGMPLAASLGFGHPALTQ---I---G-GYS---PKIKPEHVVLIGVRSLDEGEKKFIREKGIKIYTMHEVDRLGMTRVMEETIAYL--KE-RTDGVHLSLDLDGLDPSDAPGVGTPVIGGLTYRESHLAMEMLAEAQIITSAEFVEVNPIL----DER----NK-----------TASVAVALMGSLFGEKLM
104 HHSearch 72.1042% -2 - C7 -2AEB ARGI1_HUMAN A:[5-307] -SRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQE-----CDVKDYGDLPFAD-IPN-D--SP--FQIV---KNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGF---S-WVT---PCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGR--KKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSL----GKTPEEVTR-----------TVNTAVAITLACFGLA--
103 HHSearch 71.7634% -37 - C7 -3SL1 ? A:[24-405] --KNVSIIGSPLAAGQPLGGVQLACDDLRKLGLHNVIDVLG-----WKYEDIGNIDN----------CY--YDNI---RNIKEIGIFSKNLFDTMSNELRKKNFVLNIGGDHGVAFSSILSSLQMYQNLRVIWIDAHGDINIPETSPSGNYHGMTLAHTLGLFKKKVPYFE-W---S-ENL---TYLKPENTAIIGIRDIDAYEKIILKKCNINYYTIFDIEKNGIYNTICTALEKI--DPNSNCPIHISLDIDSVDNVFAPGTGTVAKGGLNYREINLLMKILAETKRVVSMDLVEYNPSL----DEV----DKKVHGDSLPILDNATKTGKLCLELIA----
99 PsiBlast_CBE 71.2442% 14 - C7 -4HXQ ARGI1_HUMAN B:[2-301] --RTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQE-----CDVKDYGDLPF---AD--I--PN--DSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPD---V---P-GFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGR--KKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEV----TR-----------TVNTAVAITLACFG----
92 PsiBlast_CBE 70.8442% 16 - C7 -2PLL ARGI1_HUMAN B:[6-305] --RTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQE-----CDVKDYGDLPF---AD--I--PN--DSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPD---V---P-GFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGR--KKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEV----TR-----------TVNTAVAITLACFG----
87 PsiBlast_CBE 70.7342% 16 - C7 -3GN0 ARGI1_HUMAN B:[6-305] --RTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQE-----CDVKDYGDLPF---AD--I--PN--DSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPD---V---P-GFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGR--KKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEV----TR-----------TVNTAVAITLACFG----
56 PsiBlast_CBE 70.4742% 12 - C7 -4GSZ ARGI1_HUMAN A:[6-305] --RTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQE-----CDVKDYGDLPF---AD--I--PN--DSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPD---V---P-GFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGR--KKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEV----TR-----------TVNTAVAITLACFG----
62 PsiBlast_CBE 70.3942% 17 - C7 -4FCK ARGI1_HUMAN A:[6-305] --RTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQE-----CDVKDYGDLPF---AD--I--PN--DSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPD---V---P-GFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGR--KKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEV----TR-----------TVNTAVAITLACFG----