@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu40340: (2016-08-07 )
MTALSKSKEIIDQTSHYGANNYHPLPIVISEALGAWVKDPEGNEYMDMLSAYSAVNQGHRHPKIIQALKDQADKITLTSRAFHNDQLGPFYEKTAKLTGKEMILPMNTGAEAVESAVKAARRWAYEVKGVADNQAEIIACVGNFHGRTMLAVSLSSEEEYKRGFGPMLPGIKLIPYGDVEALRQAITPNTAAFLFEPIQGEAGIVIPPEGFLQEAAAICKEENVLFIADEIQTGLGRTGKTFACDWDGIVPDMYILGKALGGGVFPISCIAADREILGVFNPGSHGSTFGGNPLACAVSIASLEVLEDEKLADRSLELGEYFKSELESIDSPVIKEVRGRGLFIGVELTEAARPYCERLKEEGLLCKETHDTVIRFAPPLIISKEDLDWAIEKIKHVLRNA

Atome Classification :

(56 SA) -----.........10........20..-.---.....30........40........50........-60........70.....-...80...--.....90........------100-----.......110.......120.......--130.......140.......150....-...160..-.....170......---------------------.180....-.-.-.------190.......200.......210.......220.......230.......240.......250.......260......---.270--------........280..--.....290.......300.......310.......320......-.---330-.--.......340......----.350--.----.---..--.....----------------------360...-----------....---------.-370.......380.......390.......400
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) -----MTALSKSKEIIDQTSHYGANNYH-P---LPIVISEALGAWVKDPEGNEYMDMLSAYSAVNQGH-RHPKIIQALKDQADKIT-LTSRAFHN--DQLGPFYEKTAKLTG------KEM-----ILPMNTGAEAVESAVKAARRWAYEVKG--VADNQAEIIACVGNFHGRTMLAVSLSS-EEEYKRGF-GPMLPGIKLIPYGD---------------------VEALRQAI-T-P-N------TAAFLFEPIQGEAGIVIPPEGFLQEAAAICKEENVLFIADEIQTGLGRTGKTFACDWDGIVPDMYILGKALGGGVFPIS---CIA---------ADREILGVFNPGS--HGSTFGGNPLACAVSIASLEVLEDEKLADRSLELGEYFKSELES-I---DS--P--VIKEVRGRGLFIGVEL----TE----A----A---RP--YCERL----------------------K-EEGL-----------LCKE---------T-HDTVIRFAPPLIISKEDLDWAIEKIKHVLRNA
106 HHSearch 93.3978%-104 - C1 -3RUY - OAT_BACAN A:[11-395] ------------------TDTYGANNYH-P---LPIVISKAEGVWVEDPEGNRYMDLLSAYSAVNQGH-RHPKIINALIDQANRVT-LTSRAFHS--DQLGPWYEKVAKLTN------KEM-----VLPMNTGAEAVETAIKTARRWAYDVKK--VEANRAEIIVCEDNFHGRTMGAVSMSS-NEEYKRGF-GPMLPGIIVIPYGD---------------------LEALKAAI-T-P-N------TAAFILEPIQGEAGINIPPAGFLKEALEVCKKENVLFVADEIQTGLGRTGKVFACDWDNVTPDMYILGKALGGGVFPIS---CAA---------ANRDILGVFEPGS--HGSTFGGNPLACAVSIAALEVLEEEKLTERSLQLGEKLVGQLKE-I---DN--P--MITEVRGKGLFIGIEL----NE----P----A---RP--YCEQL----------------------K-AAGL-----------LCKE---------T-HENVIRIAPPLVISEEDLEWAFQKIKAVL---
1 PsiBlast_PDB 93.0776%-104 - C1 -3RUY - OAT_BACAN A:[5-395] ------------KDIIELTDTYGANNYH-P---LPIVISKAEGVWVEDPEGNRYMDLLSAYSAVNQGH-RHPKIINALIDQANRVT-LTSRAFHS--DQLGPWYEKVAKLTN------KEM-----VLPMNTGAEAVETAIKTARRWAYDVKK--VEANRAEIIVCEDNFHGRTMGAVSMSS-NEEYKRGF-GPMLPGIIVIPYGD---------------------LEALKAAI-T-P-N------TAAFILEPIQGEAGINIPPAGFLKEALEVCKKENVLFVADEIQTGLGRTGKVFACDWDNVTPDMYILGKALGGGVFPIS---CAA---------ANRDILGVFEPGS--HGSTFGGNPLACAVSIAALEVLEEEKLTERSLQLGEKLVGQLKE-I---DN--P--MITEVRGKGLFIGIEL----NE----P----A---RP--YCEQL----------------------K-AAGL-----------LCKE---------T-HENVIRIAPPLVISEEDLEWAFQKIKAVL---
101 HHSearch 75.1350% -38 - C1 -2OAT OAT_HUMAN A:[37-438] --------PPTSDDIFEREYKYGAHNYH-P---LPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGH-CHPKIVNALKSQVDKLT-LTSRAFYN--NVLGEYEEYITKLFN------YHK-----VLPMNTGVEAGETACKLARKWGYTVKG--IQKYKAKIVFAAGNFWGRTLSAISSST-DPTSYDGF-GPFMPGFDIIPYND---------------------LPALERALQD-P-N------VAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVS---AVL---------CDDDIMLTIKPGE--HGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMK-L---PS--D--VVTAVRGKGLLNAIVI----KE----TKDWDA---WK--VCLRL----------------------R-DNGL-----------LAKP---------T-HGDIIRFAPPLVIKEDELRESIEIINKTILS-
3 PsiBlast_PDB 73.6649% -40 - C1 -2OAT OAT_HUMAN A:[40-436] -----------SDDIFEREYKYGAHNYH-P---LPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGH-CHPKIVNALKSQVDKLT-LTSRAFYN--NVLGEYEEYITKLFN------YHK-----VLPMNTGVEAGETACKLARKWGYTVKG--IQKYKAKIVFAAGNFWGRTLSAISSST-DPTSYDGF-GPFMPGFDIIPYND---------------------LPALERAL-QDP-N------VAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVS---AVL---------CDDDIMLTIKPGE--HGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMK-L---PS--D--VVTAVRGKGLLNAIVI----KE----TKDWDA---WK--VCLRL----------------------R-DNGL-----------LAKP---------T-HGDIIRFAPPLVIKEDELRESIEIINKTI---
21 PsiBlast_CBE 72.9749% -41 - C1 -2OAT OAT_HUMAN C:[40-436] -----------SDDIFEREYKYGAHNYH-P---LPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGH-CHPKIVNALKSQVDKLT-LTSRAFYN--NVLGEYEEYITKLFN------YHK-----VLPMNTGVEAGETACKLARKWGYTVKG--IQKYKAKIVFAAGNFWGRTLSAISSST-DPTSYDGF-GPFMPGFDIIPYND---------------------LPALERAL-QDP-N------VAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVS---AVL---------CDDDIMLTIKPGE--HGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMK-L---PS--D--VVTAVRGKGLLNAIVI----KE----TKDWDA---WK--VCLRL----------------------R-DNGL-----------LAKP---------T-HGDIIRFAPPLVIKEDELRESIEIINKTI---
23 PsiBlast_CBE 72.6249% -39 - C1 -1OAT OAT_HUMAN C:[40-436] -----------SDDIFEREYKYGAHNYH-P---LPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGH-CHPKIVNALKSQVDKLT-LTSRAFYN--NVLGEYEEYITKLFN------YHK-----VLPMNTGVEAGETACKLARKWGYTVKG--IQKYKAKIVFAAGNFWGRTLSAISSST-DPTSYDGF-GPFMPGFDIIPYND---------------------LPALERAL-QDP-N------VAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVS---AVL---------CDDDIMLTIKPGE--HGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMK-L---PS--D--VVTAVRGKGLLNAIVI----KE----TKDWDA---WK--VCLRL----------------------R-DNGL-----------LAKP---------T-HGDIIRFAPPLVIKEDELRESIEIINKTI---
22 PsiBlast_CBE 72.4649% -42 - C1 -2OAT OAT_HUMAN B:[40-436] -----------SDDIFEREYKYGAHNYH-P---LPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGH-CHPKIVNALKSQVDKLT-LTSRAFYN--NVLGEYEEYITKLFN------YHK-----VLPMNTGVEAGETACKLARKWGYTVKG--IQKYKAKIVFAAGNFWGRTLSAISSST-DPTSYDGF-GPFMPGFDIIPYND---------------------LPALERAL-QDP-N------VAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVS---AVL---------CDDDIMLTIKPGE--HGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMK-L---PS--D--VVTAVRGKGLLNAIVI----KE----TKDWDA---WK--VCLRL----------------------R-DNGL-----------LAKP---------T-HGDIIRFAPPLVIKEDELRESIEIINKTI---
24 PsiBlast_CBE 72.3849% -39 - C1 -1OAT OAT_HUMAN B:[40-436] -----------SDDIFEREYKYGAHNYH-P---LPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGH-CHPKIVNALKSQVDKLT-LTSRAFYN--NVLGEYEEYITKLFN------YHK-----VLPMNTGVEAGETACKLARKWGYTVKG--IQKYKAKIVFAAGNFWGRTLSAISSST-DPTSYDGF-GPFMPGFDIIPYND---------------------LPALERAL-QDP-N------VAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVS---AVL---------CDDDIMLTIKPGE--HGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMK-L---PS--D--VVTAVRGKGLLNAIVI----KE----TKDWDA---WK--VCLRL----------------------R-DNGL-----------LAKP---------T-HGDIIRFAPPLVIKEDELRESIEIINKTI---
28 PsiBlast_CBE 72.1649% -38 - C1 -1GBN OAT_HUMAN B:[3-399] -----------SDDIFEREYKYGAHNYH-P---LPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGH-CHPKIVNALKSQVDKLT-LTSRAFYN--NVLGEYEEYITKLFN------YHK-----VLPMNTGVEAGETACKLARKWGYTVKG--IQKYKAKIVFAAGNFWGRTLSAISSST-DPTSYDGF-GPFMPGFDIIPYND---------------------LPALERAL-QDP-N------VAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVS---AVL---------CDDDIMLTIKPGE--HGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMK-L---PS--D--VVTAVRGKGLLNAIVI----KE----TKDWDA---WK--VCLRL----------------------R-DNGL-----------LAKP---------T-HGDIIRFAPPLVIKEDELRESIEIINKTI---
2 PsiBlast_PDB 71.9449% -39 - C1 -1OAT OAT_HUMAN A:[40-436] -----------SDDIFEREYKYGAHNYH-P---LPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGH-CHPKIVNALKSQVDKLT-LTSRAFYN--NVLGEYEEYITKLFN------YHK-----VLPMNTGVEAGETACKLARKWGYTVKG--IQKYKAKIVFAAGNFWGRTLSAISSST-DPTSYDGF-GPFMPGFDIIPYND---------------------LPALERAL-QDP-N------VAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVS---AVL---------CDDDIMLTIKPGE--HGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMK-L---PS--D--VVTAVRGKGLLNAIVI----KE----TKDWDA---WK--VCLRL----------------------R-DNGL-----------LAKP---------T-HGDIIRFAPPLVIKEDELRESIEIINKTI---
4 PsiBlast_PDB 71.9249% -37 - C1 -2CAN OAT_HUMAN A:[3-399] -----------SDDIFEREYKYGAHNYH-P---LPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGH-CHPKIVNALKSQVDKLT-LTSRAFYN--NVLGEYEEYITKLFN------YHK-----VLPMNTGVEAGETACKLARKWGYTVKG--IQKYKAKIVFAAGNFWGRTLSAISSST-DPTSYDGF-GPFMPGFDIIPYND---------------------LPALERAL-QDP-N------VAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVS---AVL---------CDDDIMLTIKPGE--HGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMK-L---PS--D--VVTAVRGKGLLNAIVI----KE----TKDWDA---WK--VCLRL----------------------R-DNGL-----------LAKP---------T-HGDIIRFAPPLVIKEDELRESIEIINKTI---
7 PsiBlast_PDB 71.8848% -42 - C1 -2BYL OAT_HUMAN A:[40-436] -----------SDDIFEREYKYGAHNAH-P---LPVALERGKGIYLWDVEGRKYFDFLSSISAVNQGH-CHPKIVNALKSQVDKLT-LTSRAFYN--NVLGEYEEYITKLFN------YHK-----VLPMNTGVEAGETACKLARKWGYTVKG--IQKYKAKIVFAAGNFWGRTLSAISSST-DPTSYDGF-GPFMPGFDIIPYND---------------------LPALERAL-QDP-N------VAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVS---AVL---------CDDDIMLTIKPGE--HFSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMK-L---PS--D--VVTAVRGKGLLNAIVI----KE----TKDWDA---WK--VCLRL----------------------R-DNGL-----------LAKP---------T-HGDIIRFAPPLVIKEDELRESIEIINKTI---
27 PsiBlast_CBE 71.7349% -39 - C1 -1GBN OAT_HUMAN C:[3-399] -----------SDDIFEREYKYGAHNYH-P---LPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGH-CHPKIVNALKSQVDKLT-LTSRAFYN--NVLGEYEEYITKLFN------YHK-----VLPMNTGVEAGETACKLARKWGYTVKG--IQKYKAKIVFAAGNFWGRTLSAISSST-DPTSYDGF-GPFMPGFDIIPYND---------------------LPALERAL-QDP-N------VAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVS---AVL---------CDDDIMLTIKPGE--HGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMK-L---PS--D--VVTAVRGKGLLNAIVI----KE----TKDWDA---WK--VCLRL----------------------R-DNGL-----------LAKP---------T-HGDIIRFAPPLVIKEDELRESIEIINKTI---
31 PsiBlast_CBE 71.5048% -41 - C1 -2BYL OAT_HUMAN C:[40-436] -----------SDDIFEREYKYGAHNAH-P---LPVALERGKGIYLWDVEGRKYFDFLSSISAVNQGH-CHPKIVNALKSQVDKLT-LTSRAFYN--NVLGEYEEYITKLFN------YHK-----VLPMNTGVEAGETACKLARKWGYTVKG--IQKYKAKIVFAAGNFWGRTLSAISSST-DPTSYDGF-GPFMPGFDIIPYND---------------------LPALERAL-QDP-N------VAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVS---AVL---------CDDDIMLTIKPGE--HFSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMK-L---PS--D--VVTAVRGKGLLNAIVI----KE----TKDWDA---WK--VCLRL----------------------R-DNGL-----------LAKP---------T-HGDIIRFAPPLVIKEDELRESIEIINKTI---
25 PsiBlast_CBE 71.4149% -38 - C1 -2CAN OAT_HUMAN C:[3-399] -----------SDDIFEREYKYGAHNYH-P---LPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGH-CHPKIVNALKSQVDKLT-LTSRAFYN--NVLGEYEEYITKLFN------YHK-----VLPMNTGVEAGETACKLARKWGYTVKG--IQKYKAKIVFAAGNFWGRTLSAISSST-DPTSYDGF-GPFMPGFDIIPYND---------------------LPALERAL-QDP-N------VAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVS---AVL---------CDDDIMLTIKPGE--HGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMK-L---PS--D--VVTAVRGKGLLNAIVI----KE----TKDWDA---WK--VCLRL----------------------R-DNGL-----------LAKP---------T-HGDIIRFAPPLVIKEDELRESIEIINKTI---
29 PsiBlast_CBE 71.2349% -37 - C1 -2BYJ OAT_HUMAN C:[40-436] -----------SDDIFEREYKYGAHNYH-P---LPVALERGKGIYLWDVEGRKYFDFLSSISAVNQGH-CHPKIVNALKSQVDKLT-LTSRAFYN--NVLGEYEEYITKLFN------YHK-----VLPMNTGVEAGETACKLARKWGYTVKG--IQKYKAKIVFAAGNFWGRTLSAISSST-DPTSYDGF-GPFMPGFDIIPYND---------------------LPALERAL-QDP-N------VAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVS---AVL---------CDDDIMLTIKPGE--HGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMK-L---PS--D--VVTAVRGKGLLNAIVI----KE----TKDWDA---WK--VCLRL----------------------R-DNGL-----------LAKP---------T-HGDIIRFAPPLVIKEDELRESIEIINKTI---
26 PsiBlast_CBE 71.1749% -38 - C1 -2CAN OAT_HUMAN B:[3-399] -----------SDDIFEREYKYGAHNYH-P---LPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGH-CHPKIVNALKSQVDKLT-LTSRAFYN--NVLGEYEEYITKLFN------YHK-----VLPMNTGVEAGETACKLARKWGYTVKG--IQKYKAKIVFAAGNFWGRTLSAISSST-DPTSYDGF-GPFMPGFDIIPYND---------------------LPALERAL-QDP-N------VAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVS---AVL---------CDDDIMLTIKPGE--HGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMK-L---PS--D--VVTAVRGKGLLNAIVI----KE----TKDWDA---WK--VCLRL----------------------R-DNGL-----------LAKP---------T-HGDIIRFAPPLVIKEDELRESIEIINKTI---
5 PsiBlast_PDB 71.0649% -39 - C1 -1GBN OAT_HUMAN A:[3-399] -----------SDDIFEREYKYGAHNYH-P---LPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGH-CHPKIVNALKSQVDKLT-LTSRAFYN--NVLGEYEEYITKLFN------YHK-----VLPMNTGVEAGETACKLARKWGYTVKG--IQKYKAKIVFAAGNFWGRTLSAISSST-DPTSYDGF-GPFMPGFDIIPYND---------------------LPALERAL-QDP-N------VAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVS---AVL---------CDDDIMLTIKPGE--HGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMK-L---PS--D--VVTAVRGKGLLNAIVI----KE----TKDWDA---WK--VCLRL----------------------R-DNGL-----------LAKP---------T-HGDIIRFAPPLVIKEDELRESIEIINKTI---
32 PsiBlast_CBE 70.9348% -42 - C1 -2BYL OAT_HUMAN B:[40-436] -----------SDDIFEREYKYGAHNAH-P---LPVALERGKGIYLWDVEGRKYFDFLSSISAVNQGH-CHPKIVNALKSQVDKLT-LTSRAFYN--NVLGEYEEYITKLFN------YHK-----VLPMNTGVEAGETACKLARKWGYTVKG--IQKYKAKIVFAAGNFWGRTLSAISSST-DPTSYDGF-GPFMPGFDIIPYND---------------------LPALERAL-QDP-N------VAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVS---AVL---------CDDDIMLTIKPGE--HFSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMK-L---PS--D--VVTAVRGKGLLNAIVI----KE----TKDWDA---WK--VCLRL----------------------R-DNGL-----------LAKP---------T-HGDIIRFAPPLVIKEDELRESIEIINKTI---
6 PsiBlast_PDB 70.8349% -39 - C1 -2BYJ OAT_HUMAN A:[40-436] -----------SDDIFEREYKYGAHNYH-P---LPVALERGKGIYLWDVEGRKYFDFLSSISAVNQGH-CHPKIVNALKSQVDKLT-LTSRAFYN--NVLGEYEEYITKLFN------YHK-----VLPMNTGVEAGETACKLARKWGYTVKG--IQKYKAKIVFAAGNFWGRTLSAISSST-DPTSYDGF-GPFMPGFDIIPYND---------------------LPALERAL-QDP-N------VAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVS---AVL---------CDDDIMLTIKPGE--HGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMK-L---PS--D--VVTAVRGKGLLNAIVI----KE----TKDWDA---WK--VCLRL----------------------R-DNGL-----------LAKP---------T-HGDIIRFAPPLVIKEDELRESIEIINKTI---
14 PsiBlast_PDB 70.6449% -38 - C1 -5EQC ? A:[43-428] --------------------QYVCQNYA-P---VPVVISKGKGARVWDINGNEYYDFLAGVSSLSQGH-CHPRVIAALCRQAERLT-LTLRAFGN--DVTGPACRFMAEMFG------YDR-----VLLMNTGAEAGESALKIARKWAYEVKE--IPPDSAKVILCNNNYWGRTITACSSST-TFDCYNNF-GPFTPGFELIDYDD---------------------VGALEEAL-KDP-N------VAAFFVEPIQGEGGVNVPKPGYLKRAHELCRSKNVLLIVDEIQTGLCRTGRLLAADHDEVHPDILLLGKSLSAGVVPIS---AVM---------GRADVMDVLKPGT--HGSTFGGNPLACAVAVEALTVLKDEKLADRAERLGAQFRDCLRR-ELYGKV--P--WIKEIRGRGLLNAVEVD---SD----A----I---DPNDVVMKL----------------------K-ENGI-----------LSKP---------T-RGRVMRFIPPLVITDEEHRDATTRI-------
103 HHSearch 70.5648% -33 - C1 -4NOG ? A:[18-419] ----------TEEDFFACDRQYVCQNYA-P---VPVVISKGKGARVWDINGNEYYDFLAGVSSLSQGH-CHPRVIAALCRQAERLT-LTLRAFGN--DVTGPACRFMAEMFG------YDR-----VLLMNTGAEAGESALKIARKWAYEVKE--IPPDSAKVILCNNNYWGRTITACSSST-TFDCYNNF-GPFTPGFELIDYDD---------------------VGALEEAL-KDP-N------VAAFFVEPIQGEGGVNVPKPGYLKRAHELCRSKNVLLIVDEIQTGLCRTGRLLAADHDEVHPDILLLGKSLSAGVVPIS---AVM---------GRADVMDVLKPGT--HGSTFGGNPLACAVAVEALTVLKDEKLADRAERLGAQFRDCLRREL---YGKVP--WIKEIRGRGLLNAVEV----DSDAI-D----P---ND--VVMKL----------------------K-ENGI-----------LSKP---------T-RGRVMRFIPPLVITDEEHRDATTRIIKSFLA-
30 PsiBlast_CBE 70.5649% -39 - C1 -2BYJ OAT_HUMAN B:[40-436] -----------SDDIFEREYKYGAHNYH-P---LPVALERGKGIYLWDVEGRKYFDFLSSISAVNQGH-CHPKIVNALKSQVDKLT-LTSRAFYN--NVLGEYEEYITKLFN------YHK-----VLPMNTGVEAGETACKLARKWGYTVKG--IQKYKAKIVFAAGNFWGRTLSAISSST-DPTSYDGF-GPFMPGFDIIPYND---------------------LPALERAL-QDP-N------VAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVS---AVL---------CDDDIMLTIKPGE--HGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMK-L---PS--D--VVTAVRGKGLLNAIVI----KE----TKDWDA---WK--VCLRL----------------------R-DNGL-----------LAKP---------T-HGDIIRFAPPLVIKEDELRESIEIINKTI---
39 PsiBlast_CBE 69.7749% -38 - C1 -4ZWM ? B:[43-428] --------------------QYVCQNYA-----VPVVISKGKGARVWDINGNEYYDFLAGVSSLSQGH-CHPRVIAALCRQAERLT-LTLRAFGN--DVTGPACRFMAEMFG------YDR-----VLLMNTGAEAGESALKIARKWAYEVKE--IPPDSAKVILCNNNYWGRTITACSSST-TFDCYNNF-GPFTPGFELIDYDD---------------------VGALEEAL-KDP-N------VAAFFVEPIQGEGGVNVPKPGYLKRAHELCRSKNVLLIVDEIQTGLCRTGRLLAADHDEVHPDILLLGKSLSAGVVPIS---AVM---------GRADVMDVLKPGT--HGSTFGGNPLACAVAVEALTVLKDEKLADRAERLGAQFRDCLRR-ELYGKV--P--WIKEIRGRGLLNAVEVD---SD----A----I---DPNDVVMKL----------------------K-ENGI-----------LSKP---------T-RGRVMRFIPPLVITDEEHRDATTRI-------
40 PsiBlast_CBE 69.0249% -36 - C1 -4ZLV ? B:[43-428] --------------------QYVCQNYA-P---VPVVISKGKGARVWDINGNEYYDFLAGVSSLSQGH-CHPRVIAALCRQAERLT-LTLRAFGN--DVTGPACRFMAEMFG------YDR-----VLLMNTGAEAGESALKIARKWAYEVKE--IPPDSAKVILCNNNYWGRTITACSSST-TFDCYNNF-GPFTPGFELIDYDD---------------------VGALEEAL-KDP-N------VAAFFVEPIQGEGGVNVPKPGYLKRAHELCRSKNVLLIVDEIQTGLCRTGRLLAADHDEVHPDILLLGKSLSAGVVPIS---AVM---------GRADVMDVLKPGT--HGSTFGGNPLACAVAVEALTVLKDEKLADRAERLGAQFRDCLRR-ELYGKV--P--WIKEIRGRGLLNAVEVD---SD----A----I---DPNDVVMKL----------------------K-ENGI-----------LSKP---------T-RGRVMRFIPPLVITDEEHRDATTRI-------
10 PsiBlast_PDB 68.4449% -36 - C1 -4NOG ? A:[28-413] --------------------QYVCQNYA-P---VPVVISKGKGARVWDINGNEYYDFLAGVSSLSQGH-CHPRVIAALCRQAERLT-LTLRAFGN--DVTGPACRFMAEMFG------YDR-----VLLMNTGAEAGESALKIARKWAYEVKE--IPPDSAKVILCNNNYWGRTITACSSST-TFDCYNNF-GPFTPGFELIDYDD---------------------VGALEEAL-KDP-N------VAAFFVEPIQGEGGVNVPKPGYLKRAHELCRSKNVLLIVDEIQTGLCRTGRLLAADHDEVHPDILLLGKSLSAGVVPIS---AVM---------GRADVMDVLKPGT--HGSTFGGNPLACAVAVEALTVLKDEKLADRAERLGAQFRDCLRR-ELYGKV--P--WIKEIRGRGLLNAVEVD---SD----A----I---DPNDVVMKL----------------------K-ENGI-----------LSKP---------T-RGRVMRFIPPLVITDEEHRDATTRI-------
11 PsiBlast_PDB 68.2749% -35 - C1 -4ZLV ? A:[43-428] --------------------QYVCQNYA-P---VPVVISKGKGARVWDINGNEYYDFLAGVSSLSQGH-CHPRVIAALCRQAERLT-LTLRAFGN--DVTGPACRFMAEMFG------YDR-----VLLMNTGAEAGESALKIARKWAYEVKE--IPPDSAKVILCNNNYWGRTITACSSST-TFDCYNNF-GPFTPGFELIDYDD---------------------VGALEEAL-KDP-N------VAAFFVEPIQGEGGVNVPKPGYLKRAHELCRSKNVLLIVDEIQTGLCRTGRLLAADHDEVHPDILLLGKSLSAGVVPIS---AVM---------GRADVMDVLKPGT--HGSTFGGNPLACAVAVEALTVLKDEKLADRAERLGAQFR