@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu40410: (2016-08-07 )
MDKKILVVDDEKPIADILEFNLRKEGYEVHCAHDGNEAVEMVEELQPDLILLDIMLPNKDGVEVCREVRKKYDMPIIMLTAKDSEIDKVIGLEIGADDYVTKPFSTRELLARVKANLRRQLTTAPAEEEPSSNEIHIGSLVIFPDAYVVSKRDETIELTHREFELLHYLAKHIGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDNPSHPNWIVTRRGVGYYLRNPEQD

Atome Classification :

(21 SA) .........10........20........30........40........50........60..-......70-.-.......80........90........100.......110.......-120.......130.......140...------....150.......160.......170.......180.......190.......200.......210.......220.......230...
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MDKKILVVDDEKPIADILEFNLRKEGYEVHCAHDGNEAVEMVEELQPDLILLDIMLPNKDGVE-VCREVRKK-Y-DMPIIMLTAKDSEIDKVIGLEIGADDYVTKPFSTRELLARVKANLRR-QLTTAPAEEEPSSNEIHIGSLVIFPD------AYVVSKRDETIELTHREFELLHYLAKHIGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDNPSHPNWIVTRRGVGYYLRNPEQD
19 PsiBlast_PDB 85.7745%-137 - C5 -2GWR MTRA_MYCTU A:[6-228] --QRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRPDLVLLDLMLPGMNGID-VCRVLRAD-S-GVPIVMLTAKTDTVDVVLGLESGADDYIMKPFKPKELVARVRARLRR-N------DDEP-AEMLSIADVEIDVP------AHKVTRNGEQISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYR--ADTRLVNVHVQRLRAKVEKDPENPTVVLTVRGVGYKAGPP---
103 HHSearch 85.4346%-138 - C5 -2GWR MTRA_MYCTU A:[6-228] --QRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRPDLVLLDLMLPGMNGID-VCRVLRAD-S-GVPIVMLTAKTDTVDVVLGLESGADDYIMKPFKPKELVARVRARLRR-NDDEPAE-------MLSIADVEIDVP------AHKVTRNGEQISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYR--ADTRLVNVHVQRLRAKVEKDPENPTVVLTVRGVGYKAGPP---
106 HHSearch 78.8045% -69 - C5 -1YS7 PRRA_MYCTU A:[8-232] --PRVLVVDDDSDVLASLERGLRLSGFEVATAVDGAEALRSATENRPDAIVLDINMPVLDGVS-VVTALRAM-DNDVPVCVLSARSSVDDRVAGLEAGADDYLVKPFVLAELVARVKALLRR-RGSTATS----SSETITVGPLEVDIP------GRRARVNGVDVDLTKREFDLLAVLAEHKTAVLSRAQLLELVWGYDFA-DTNVVDVFIGYLRRKLEAG---PRLLHTVRGVGFVLRM----
21 PsiBlast_CBE 74.24100%-131 - C4 -2ZWM YYCF_BACSU B:[2-121] -DKKILVVDDEKPIADILEFNLRKEGYEVHCAHDGNEAVEMVEELQPDLILLDIMLPNKDGVE-VCREVRKK-Y-DMPIIMLTAKDSEIDKVIGLEIGADDYVTKPFSTRELLARVKANLRR-QL------------------------------------------------------------------------------------------------------------------------
2 PsiBlast_PDB 74.24100%-129 - C4 -3F6P - YYCF_BACSU A:[1-120] MDKKILVVDDEKPIADILEFNLRKEGYEVHCAHDGNEAVEMVEELQPDLILLDIMLPNKDGVE-VCREVRKK-Y-DMPIIMLTAKDSEIDKVIGLEIGADDYVTKPFSTRELLARVKANLRR-Q-------------------------------------------------------------------------------------------------------------------------
1 PsiBlast_PDB 73.72100%-127 - C4 -2ZWM YYCF_BACSU A:[2-121] -DKKILVVDDEKPIADILEFNLRKEGYEVHCAHDGNEAVEMVEELQPDLILLDIMLPNKDGVE-VCREVRKK-Y-DMPIIMLTAKDSEIDKVIGLEIGADDYVTKPFSTRELLARVKANLRR-QL------------------------------------------------------------------------------------------------------------------------
104 HHSearch 73.0433%-140 - C5 -4KFC - KDPE_ECOLI A:[1-224] -MANVLIVEDEQAIRRFLRTALEGDGMRVFEAETLQRGLLEAATRKPDLIILDLGLPDGDGIE-FIRDLRQW-S-AVPVIVLSARSEESDKIAALDAGADDYLSKPFGIGELQARLRVALRR-HS---AP-----DPLVKFSDVTVDLA------ARVIHRGEEEVHLTPIEFRLLAVLLNNAGKVLTQRQLLNQVWGPNAVEHSHYLRIYMGHLRQKLEQDPARPRHFITATGIGYRFM-----
108 HHSearch 73.0048%-100 - C5 -2OQR REGX3_MYCTU A:[5-229] --TSVLIVEDEESLADPLAFLLRKEGFEATVVTDGPAALAEFDRAGADIVLLDLMLPGMSGTD-VCKQLRAR-S-SVPVIMVTARDSEIDKVVGLELGADDYVTKPYSARELIARIRAVLRR-GGDDDSEM---SDGVLESGPVRMDVE------RHVVSVNGDTITLPLKEFDLLEYLMRNSGRVLTRGQLIDRVWGADYVGDTKTLDVHVKRLRSKIEADPANPVHLVTVRGLGYKLE-----
4 PsiBlast_PDB 72.9247% -99 - C5 -2OQR REGX3_MYCTU A:[4-228] -ATSVLIVEDEESLADPLAFLLRKEGFEATVVTDGPAALAEFDRAGADIVLLDLMLPGMSGTD-VCKQLRAR-S-SVPVIMVTARDSEIDKVVGLELGADDYVTKPYSARELIARIRAVLRR-G---GDDDSEMSDGVLESGPVRMDVE------RHVVSVNGDTITLPLKEFDLLEYLMRNSGRVLTRGQLIDRVWGADYVGDTKTLDVHVKRLRSKIEADPANPVHLVTVRGLGYKL------
16 PsiBlast_PDB 71.3244% -60 - C5 -1YS6 PRRA_MYCTU A:[23-231] -----------------LERGLRLSGFEVATAVDGAEALRSATENRPDAIVLDINMPVLDGVS-VVTALRAMDN-DVPVCVLSAR--VDDRVAGLEAGADDYLVKPFVLAELVARVKALLRR-RGSTATS----SSETITVGPLEVDIP------GRRARVNGVDVDLTKREFDLLAVLAEHKTAVLSRAQLLELVWGYDFAADTNVVDVFIGYLRRKLEAG-GGPRLLHTVRGVGFVLR-----
23 PsiBlast_CBE 70.6044% -56 - C5 -1YS6 PRRA_MYCTU B:[23-231] -----------------LERGLRLSGFEVATAVDGAEALRSATENRPDAIVLDINMPVLDGVS-VVTALRAMDN-DVPVCVLSARSSVDDRVAGLEAGADDYLVKPFVLAELVARVKALLRR-RGSTATS----SSETITVGPLEVDIP------GRRARVNGVDVDLTKREFDLLAVLAEHKTAVLSRAQLLELVWGYDFAADTNVVDVFIGYLRRKLEAG-GGPRLLHTVRGVGFVLR-----
22 PsiBlast_CBE 70.2944% -56 - C5 -1YS7 PRRA_MYCTU B:[23-231] -----------------LERGLRLSGFEVATAVDGAEALRSATENRPDAIVLDINMPVLDGVS-VVTALRAMDN-DVPVCVLSARSSVDDRVAGLEAGADDYLVKPFVLAELVARVKALLRR-RGSTATS----SSETITVGPLEVDIP------GRRARVNGVDVDLTKREFDLLAVLAEHKTAVLSRAQLLELVWGYDFAADTNVVDVFIGYLRRKLEAG-G-PRLLHTVRGVGFVLR-----
17 PsiBlast_PDB 70.1544% -63 - C5 -1YS7 PRRA_MYCTU A:[23-231] -----------------LERGLRLSGFEVATAVDGAEALRSATENRPDAIVLDINMPVLDGVS-VVTALRAMDN-DVPVCVLSARSSVDDRVAGLEAGADDYLVKPFVLAELVARVKALLRR-RGSTATS----SSETITVGPLEVDIP------GRRARVNGVDVDLTKREFDLLAVLAEHKTAVLSRAQLLELVWGYDFA-DTNVVDVFIGYLRRKLEAG---PRLLHTVRGVGFVLR-----
110 HHSearch 69.2738% -75 - C5 -1P2F - ? A:[2-217] -MWKIAVVDDDKNILKKVSEKLQQLGR-VKTFLTGEDFLN--DEEAFHVVVLDVMLPDYSGYE-ICRMIKET-RPETWVILLTLLSDDESVLKGFEAGADDYVTKPFNPEILLARVKRFLER-EKKGLY----------DFGDLKIDAT------GFTVFLKGKRIHLPKKEFEILLFLAENAGKVVTREKLLETFWEDP--VSPRVVDTVIKRIRKAIEDDPNRPRYIKTIWGVGYMFTG----
39 PsiBlast_CBE 68.7634% -64 - C4 -4S04 ? F:[2-218] ---KILVIEDDALLLQGLILAMQSEGYVCDGVSTAHEAALSLASNHYSLIVLDLGLPDEDGLHFLSRMRREK-M-TQPVLILTARDTLEDRISGLDTGADDYLVKPFALEELNARIRALLRR-H-------NNQGDNEISVGNLRLNVT------RRLVWLGETALDLTPKEYALLSRLMMKAGSPVHREILYNDIYSGDNEPATNTLEVHIHNLREKIG-----KSRIRTVRGFGYMLAN----
9 PsiBlast_PDB 67.7067%-138 - C4 -1NXS - ? A:[2-119] --KKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILD--LPEIDGLE-VAKTIRKT-S-SVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRR-S-------------------------------------------------------------------------------------------------------------------------
24 PsiBlast_CBE 67.6135% -91 - C4 -4KNY KDPE_ECOLI B:[5-223] ---NVLIVEDEQAIRRFLRTALEGDGMRVFEAETLQRGLLEAATRKPDLIILDLGLPDGDGIE-FIRDLRQW-S-AVPVIVLSARSEESDKIAALDAGADDYLSKPFGIGELQARLRVALRRHSATTAP---DP---------LVKFSDVTVDLAARVIHRGEEEVHLTPIEFRLLAVLLNNAGKVLTQRQLLNQVWGPNAVEHSHYLRIYMGHLRQKLEQDPARPRHFITETGIGY--------
12 PsiBlast_PDB 67.5367%-143 - C4 -1NXX - ? A:[2-119] --KKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILDL----IDGLE-VAKTIRKT-S-SVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRR-S-------------------------------------------------------------------------------------------------------------------------
7 PsiBlast_PDB 66.8767%-142 - C4 -1NXO - ? A:[2-119] --KKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILDLM---IDGLE-VAKTIRKT-S-SVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRR-S-------------------------------------------------------------------------------------------------------------------------
37 PsiBlast_CBE 66.5834% -75 - C4 -4S05 ? B:[2-218] ---KILVIEDDALLLQGLILAMQSEGYVCDGVSTAHEAALSLASNHYSLIVLDLGLPDEDGLHFLSRMRREK-M-TQPVLILTARDTLEDRISGLDTGADDYLVKPFALEELNARIRALLRR-H-------NNQGDNEISVGNLRLNVT------RRLVWLGETALDLTPKEYALLSRLMMKAGSPVHREILYNDIYSGDNEPATNTLEVHIHNLREKIG-----KSRIRTVRGFGYMLAN----
119 HHSearch 41.9639%-146 - C5 -4NHJ ? A:[22-115] ----------------------------------------------------------------------------------------------------------------------------------------------SLTIDPV------NRQVMLGGENVALSTADFDMLWELATHAGQIMDRDALLKNLRGVTYDGMDRSVDVAISRLRKKLLDNATEPYRIKTVRNKGYLFAPH---