@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Rv0009: (2016-04-18 )
MADCDSVTNSPLATATATLHTNRGDIKIALFGNHAPKTVANFVGLAQGTKDYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADEFHPELQFDKPYLLAMANAGPGTNGSQFFITVGKTPHLNRRHTIFGEVIDAESQRVVEAISKTATDGNDRPTDPVVIESITIS

Atome Classification :

(99 SA) .........10........20....-----....30........40........50........60........70........80...-..---.-.-.-90.-----.----.----------------------------...---...100......-.110---.......-.----120.......130......--------.--------140........150.-.......160..---.-.----.--..170........180-------------
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MADCDSVTNSPLATATATLHTNRGD-----IKIALFGNHAPKTVANFVGLAQGTKDYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGD-PT---G-T-G-R-G-----G----P----------------------------GYK---FADEFHPELQFD-KPY----LLAMANA-G----PGTNGSQFFITVGKTPHLN--------R--------R-HTIFGEVIDA-ES-QRVVEAISKTAT---D-G----N--DRP-TDPVVIESITIS-------------
103 HHSearch 96.74100%-104 - C6 -1W74 - PPIA_MYCTU A:[12-182] -----------LATATATLHTNRGD-----IKIALFGNHAPKTVANFVGLAQGTKDYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGD-PT---G-T-G-R-G-----G----P----------------------------GYK---FADEFHPELQFD-KPY----LLAMANA-G----PGTNGSQFFITVGKTPHLN--------R--------R-HTIFGEVIDA-ES-QRVVEAISKTAT---D-G----N--DRP-TDPVVIESITIS-------------
1 PsiBlast_PDB 96.74100%-104 - C6 -1W74 - PPIA_MYCTU A:[12-182] -----------LATATATLHTNRGD-----IKIALFGNHAPKTVANFVGLAQGTKDYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGD-PT---G-T-G-R-G-----G----P----------------------------GYK---FADEFHPELQFD-KPY----LLAMANA-G----PGTNGSQFFITVGKTPHLN--------R--------R-HTIFGEVIDA-ES-QRVVEAISKTAT---D-G----N--DRP-TDPVVIESITIS-------------
113 HHSearch 78.1051%-106 - C6 -2A2N PPWD1_HUMAN A:[21-176] -------------SDSAIIHTSMGD-----IHTKLFPVECPKTVENFCVHSR---------------NGYYNGHTFHRIIKGFMIQTGD-PT---G-T-G-M-G-----G----ESIW-------------------------GGE---FEDEFHSTLRHD-RPY----TLSMANA-G----SNTNGSQFFITVVPTPWLD--------N--------K-HTVFGRVTK---G-MEVVQRISNVKV---N-PK---T--DKP-YEDVSIINITVK-------------
57 PsiBlast_CBE 77.8639%-109 - C6 -1ZKC PPIL2_HUMAN A:[16-173] ----------PRGSGYVRLHTNKGD-----LNLELHCDLTPKTCENFIRLCKKH---------------YYDGTIFHRSIRNFVIQGGD-PT---G-T-G-T-G-----G----E----------------------------SYWGKPFKDEFRPNLSHT-GRG----ILSMANS-G----PNSNRSQFFITFRSCAYLD--------K--------K-HTIFGRVVGG-FD---VLTAMENVES---DPK----T--DRP-KEEIRIDATTV--------------
56 PsiBlast_CBE 77.2639%-105 - C6 -1ZKC B:[16-173] ----------PRGSGYVRLHTNKGD-----LNLELHCDLTPKTCENFIRLCKKH---------------YYDGTIFHRSIRNFVIQGGD-PT---G-T-G-T-G-----G----E----------------------------SYWGKPFKDEFRPNLSHT-GRG----ILSMANS-G----PNSNRSQFFITFRSCAYLD--------K--------K-HTIFGRVVGG-FD---VLTAMENVES---DPK----T--DRP-KEEIRIDATTV--------------
15 PsiBlast_PDB 77.2136% -95 - C6 -4R3F ? A:[11-197] ---------EPQPTGAVIIHTTQGD-----LKVELFAKQTPLTCRNFL-----------QHSLDG----YYDGTIFHRLVPGFIIQGGD-PT---G-T-G-H-G-----G----ESIYDGGAFSGDLDPWPMDQRKGHNAGPMGVN---FKDEFHSRLKFN-RRG----LLGMANE-GA---PDTNGSQFFFTLGKAEELN--------N--------K-NTLFGRVAAG-DTIYNLMKWGEAELI---E-G----T--ERP-QYPVKITNIEI--------------
117 HHSearch 76.6450%-103 - C6 -2OK3 PPIL3_HUMAN A:[1-155] --------------MSVTLHTDVGD-----IKIEVFCERTPKTCENFLALCA---------------SNYYNGCIFHRNIKGFMVQTGD-PT---G-T-G-R-G-----G----NSIW-------------------------GKK---FEDEYSEYLKHN-VRG----VVSMANN-G----PNTNGSQFFITYGKQPHLD--------M--------K-YTVFGKVID---G-LETLDELEKLPV---NEK----T--YRP-LNDVHIKDITIH-------------
108 HHSearch 76.3644%-110 - C6 -2FU0 - ? A:[5-159] -------------PKSAIIYTTMGD-----IHISLFYKECKKTVQNFSVHSI---------------NGYYNNCIFHRVIKHFMVQTGD-PS---G-D-G-T-G-----G----ESIW-------------------------GNE---FEDEFFDHLNHS-KPF----MVSMANC-G----PNTNGSQFFITTVPCPWLD--------F--------K-HTVFGKVTQ---G-SKIVLDIEKVRT---D-K----R--DKP-LEDIKILNIKIN-------------
104 HHSearch 76.0849%-107 - C6 -2X7K PPIL1_HUMAN A:[9-165] -----------WQPPNVYLETSMGI-----IVLELYWKHAPKTCKNFAELAR---------------RGYYNGTKFHRIIKDFMIQGGD-PT---G-T-G-R-G-----G----ASIY-------------------------GKQ---FEDELHPDLKFT-GAG----ILAMANA-G----PDTNGSQFFVTLAPTQWLD--------G--------K-HTIFGRVCQ---G-IGMVNRVGMVET---N-S----Q--DRP-VDDVKIIKAYPS-------------
111 HHSearch 75.8443%-100 - C6 -1ZKC PPIL2_HUMAN A:[12-174] ------SGLVPRGSGYVRLHTNKGD-----LNLELHCDLTPKTCENFIRLCK---------------KHYYDGTIFHRSIRNFVIQGGD-PT---G-T-G-T-G-----G----ESYW-------------------------GKP---FKDEFRPNLSHT-GRG----ILSMANS-G----PNSNRSQFFITFRSCAYLD--------K--------K-HTIFGRVVG---G-FDVLTAMENVES---DPK----T--DRP-KEEIRIDATTVF-------------
112 HHSearch 75.4945% -92 - C6 -4R3F ? A:[9-198] -------NLEPQPTGAVIIHTTQGD-----LKVELFAKQTPLTCRNFLQHSL---------------DGYYDGTIFHRLVPGFIIQGGD-PT---G-T-G-H-G-----G----ESIYDGGAFSGDLDPWPMDQRKGHNAGPMGVN---FKDEFHSRLKFN-RRG----LLGMANE-GA---PDTNGSQFFFTLGKAEELN--------N--------K-NTLFGRVAA---G-DTIYNLMKWGEAELIE-G----T--ERP-QYPVKITNIEIL-------------
114 HHSearch 75.3138%-107 - C6 -3BKP ? A:[12-192] ----ENLYFQGSTRGKVVLHTSLGD-----LDVELWARECPLACRNFVQLCL---------------EGYYVNTIFHRVVKDFIVQGGD-PT---G-T-G-R-G-----G----ADTTFD-----------------------GKP---FDVETHPRLKFR-YRG----LVGVANL-G------TNGNQFFITLARADVLN--------N--------A-YTLFGKVTGH--T-LYNLMKFNDLEV---G-K----E--DRP-MTPPFIKSVDVL-------------
110 HHSearch 75.1943% -97 - C6 -2B71 ? A:[34-191] ---------GHTERGYITIYTNLGD-----FEVELYWYHSPKTCLNFYTLCE---------------MGFYDNTIFHRVIPNFVIQGGD-PT---G-T-G-K-G-----G----KSIY-------------------------GEY---FEDEINKELKHT-GAG----ILSMSNN-G----PNTNSSQFFITLAPLPHLD--------G--------K-HTIFARVSK---N-MTCIENIASVQT---T-A----T--NKP-IFDLKILRTST--------------
109 HHSearch 75.0843%-104 - C6 -2POE ? A:[15-174] ------------YFQGVRIITNYGD-----LKFELFCSQCPKACKNFLALSA---------------SGYYKNTIFHKNIKGFIIQGGD-PT---G-T-G-K-G-----G----ESIY-------------------------GRY---FDDEIYPELKYD-RRG----ILSMASK-GAKK-PNTNGSQFFITYSSLPQLN--------G--------E-YVIFGKLID---G-FETLNTLENCPS---D-K----S--HKP-IDEIIIKDIVIH-------------
4 PsiBlast_PDB 74.7646%-103 - C6 -2A2N PPWD1_HUMAN A:[23-175] ---------------SAIIHTSMGD-----IHTKLFPVECPKTVENFC--------VHSRNG-------YYNGHTFHRIIKGFMIQTGD-PT---G-T-G-M-G-----G----ESIW-------------------------GGE---FEDEFHSTLRHD-RPY----TLSMANA-G----SNTNGSQFFITVVPTPWLD--------N--------K-HTVFGRV--T-KG-MEVVQRISNVKV---NPK----T--DKP-YEDVSIINITV--------------
21 PsiBlast_CBE 74.7446%-101 - C6 -2A2N C:[23-175] ---------------SAIIHTSMGD-----IHTKLFPVECPKTVENFC--------VHSRNG-------YYNGHTFHRIIKGFMIQTGD-PT---G-T-G-M-G-----G----ESIW-------------------------GGE---FEDEFHSTLRHD-RPY----TLSMANA-G----SNTNGSQFFITVVPTPWLD--------N--------K-HTVFGRV--T-KG-MEVVQRISNVKV---NPK----T--DKP-YEDVSIINITV--------------
22 PsiBlast_CBE 73.5344%-107 - C6 -2OJU PPIL3_HUMAN B:[8-160] ---------------SVTLHTDVGD-----IKIEVFCERTPKTCENFLALC---------------ASNYYNGCIFHRNIKGFMVQTGD-PT---G-T-G-R-G-----GNSI-W----------------------------GKK---FEDEYSEYLKHN-VRG----VVSMANN-G----PNTNGSQFFITYGKQPHLD--------M--------K-YTVFGKVIDGLET-LDELEKLP--VN---E-K----T--YRP-LNDVHIKDITI--------------
115 HHSearch 73.0435%-106 - C6 -3BO7 ? A:[5-172] ------------KKGYLRIVTTQGS-----LNIELHADMAPRACDSFLRLCA---------------VKYFDDTIFHRCIRNFMIQGGR-AE---L-R-Q-P--QSPRSISGFPG----------------------------GAP---FEDEFDNRLVHQ-GIG----VLSMAND-G----KHSNLSEFFITFKSCEHLN--------N--------K-HTIFGRVVG---G-LDVLRQWEKLET---D-K----K--DKP-LKPPKVEEIIVF-------------
51 PsiBlast_CBE 72.6842% -90 - C6 -2WFJ PPIG_HUMAN A:[24-176] -----------------------GR-----VVFELFSDVCPKTCENFRCLCTGEK--GTGKSTQKP--LHYKSCLFHRVVKDFMVQGGDFSE---G-N-G-R-G-----G----ESIY-------------------------GGF---FEDESFA-VKHN-KEF----LLSMANR-G----KDTNGSQFFITTKPTPHLD--------G--------H-HVVFGQVISG----QEVVREIENQKT---D-A----A--SKP-FAEVRILSC----------------
13 PsiBlast_PDB 72.4341%-104 - C6 -2QER ? A:[23-173] --------------------TNYGD-----LKFELFCSQCPKACKNFLALS----------ASG-----YYKNTIFHKNIKGFIIQGGD-PT---G-T-G-K-G-----G----ESIY-------------------------GRY---FDDEIYPELKYD-RRG----ILSMAS---ASKKPNTNGSQFFITYSSLPQLN--------G--------E-YVIFGKLIDG----FETLNTLENCPS---D-K----S--HKP-IDEIIIKDIVI--------------
7 PsiBlast_PDB 72.0146%-108 - C6 -2X7K PPIL1_HUMAN A:[16-159] ------------------LETSMGI-----IVLELYWKHAPKTCKNFAELARRG---------------YYNGTKFHRIIKDFMIQGGD-PT---G-T-G-R-G-----G----ASIY-------------------------GKQ---FEDELHPDLKFT-GAG----ILAMANA-G----PDTNGSQFFVTLAPTQWLD--------G--------K-HTIFGRV--C-QG-IGMVNRVGMVET---N-S----Q--DRP-VDDVKI-------------------
10 PsiBlast_PDB 71.8540% -92 - C6 -4R3E CWC27_HUMAN A:[10-168] ---------EPPTNGKVLLKTTAGD-----IDIELWSKEAPKACRNFIQLCLEA---------------YYDNTIFHRVVPGFIVQGGD-PT---G-T-G-S-G-----G----ESIY-------------------------GAP---FKDEFHSRLRFN-RRG----LVAMANA-G----SHDNGSQFFFTLGRADELN--------N--------K-HTIFGKVTGD-TV-YNMLR-LSEVDI---D-D----D--ERP-HNPHKIKSCEV--------------
26 PsiBlast_CBE 71.7746% -95 - C6 -2ESL PPIC_HUMAN F:[12-174] ----------PSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYG------------YKGSKFHRVIKDFMIQGGD-IT-----T-G-D-G-----T----G----------------------------GVS---IYGETFPDENFKLKHYGIG-WVSMANA-G----PDTNGSQFFITLTKPTWLD--------G--------K-HVVFGKVIDG-MT---VVHSIELQAT---D-G----H--DRPLTNCSIINS-----------------
5 PsiBlast_PDB 71.6444%-100 - C6 -2OJU PPIL3_HUMAN A:[8-160] ---------------SVTLHTDVGD-----IKIEVFCERTPKTCENFLALC---------------ASNYYNGCIFHRNIKGFMVQTGD-PT---G-T-G-R-G-----GNSI-W----------------------------GKK---FEDEYSEYLKHN-VRG----VVSMANN-G----PNTNGSQFFITYGKQPHLD--------M--------K-YTVFGKVIDGLET-LDELEKLP--VN---E-K----T--YRP-LNDVHIKDITI--------------
12 PsiBlast_PDB 71.3241%-100 - C6 -2POE ? A:[23-173] --------------------TNYGD-----LKFELFCSQCPKACKNFLALS----------ASG-----YYKNTIFHKNIKGFIIQGGD-PT---G-T-G-K-G-----G----ESIY-------------------------GRY---FDDEIYPELKYD-RRG----ILSMASK-GAKK-PNTNGSQFFITYSSLPQLN--------G--------E-YVIFGKLIDG----FETLNTLENCPS---D-K----S--HKP-IDEIIIKDIVI--------------
11 PsiBlast_PDB 71.2340% -90 - C6 -2HQ6 CWC27_HUMAN A:[19-178] --------SEPPTNGKVLLKTTAGD-----IDIELWSKEAPKACRNFIQLCLEA---------------YYDNTIFHRVVPGFIVQGGD-PT---G-T-G-S-G-----G----ESIY-------------------------GAP---FKDEFHSRLRFN-RRG----LVAMANA-G----SHDNGSQFFFTLGRADELN--------N--------K-HTIFGKVTGD-TV-YNMLR-LSEVDI---D-D----D--ERP-HNPHKIKSCEV--------------
107 HHSearch 71.1844% -91 - C6 -2HQ6 CWC27_HUMAN A:[17-179] ------RGSEPPTNGKVLLKTTAGD-----IDIELWSKEAPKACRNFIQLCL---------------EAYYDNTIFHRVVPGFIVQGGD-PT---G-T-G-S-G-----G----ESIY-------------------------GAP---FKDEFHSRLRFN-RRG----LVAMANA-G----SHDNGSQFFFTLGRADELN--------N--------K-HTIFGKVTGD--T-VYNMLRLSEVDI---D-D----D--ERP-HNPHKIKSCEVL-------------
29 PsiBlast_CBE 71.0946% -94 - C6 -2ESL PPIC_HUMAN C:[12-174] ----------PSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYG------------YKGSKFHRVIKDFMIQGGD-IT-----T-G-D-G-----T----G----------------------------GVS---IYGETFPDENFKLKHYGIG-WVSMANA-G----PDTNGSQFFITLTKPTWLD--------G--------K-HVVFGKVIDG-MT---VVHSIELQAT---D-G----H--DRPLTNCSIINS-----------------
45 PsiBlast_CBE 70.9745% -84 - C6 -2POY ? A:[30-181] -------------------QTPAGR-----ITMELFADKVPITAENFRALCTGEKG---MGQSGKPL--CYTGSFFHRIIPQFMIQGGD-FTR--G-D-G-T-G-----G----ESIY-------------------------G-K---FRDE-NFVYTHD-APF----LLSMANA-G----PNTNGSQFFITTVPCPWLD--------G--------K-HVVFGKVL---EG-MEVVKSIEKCGS---Q------N--GKP-TKSVCI-------------------
43 PsiBlast_CBE 70.9545% -87 - C6 -2POY ? C:[30-181] -------------------QTPAGR-----ITMELFADKVPITAENFRALCTGEKG---MGQSGKPL--CYTGSFFHRIIPQFMIQGGD-FTR--G-D-G-T-G-----G----ESIY-------------------------G-K---FRDE-NFVYTHD-APF----LLSMANA-G----PNTNGSQFFITTVPCPWLD--------G--------K-HVVFGKVL---EG-MEVVKSIEKCGS---Q------N--GKP-TKSVCI-------------------
34 PsiBlast_CBE 69.7745% -89 - C6 -1C5F CYP1_BRUMA M:[21-170] -----------------------GR-----IVMELYNDIAPRTCNNFLMLCTGMA--GTGKISGKPL--HYKGSTFHRVIKNFMIQGGD-FTK--G-D-G-T-G-----G----ESIY-------------------------GGM---FDDE-EFVMKHD-EPF----VVSMANK-G----PNTNGSQFFITTTPAPHLN--------N--------I-HVVFGKVVSG----QEVVTKIEYLKT---N-S----K--NRP-LADVVI-------------------
27 PsiBlast_CBE 69.7046% -93 - C6 -2ESL PPIC_HUMAN E:[12-174] ----------PSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYG------------YKGSKFHRVIKDFMIQGGD-IT-----T-G-D-G-----T----G----------------------------GVS---IYGETFPDENFKLKHYGIG-WVSMANA-G----PDTNGSQFFITLTKPTWLD--------G--------K-HVVFGKVIDG-MT---VVHSIELQAT---D-G----H--DRPLTNCSIINS-----------------
30 PsiBlast_CBE 69.5746% -93 - C6 -2ESL PPIC_HUMAN B:[12-174] ----------PSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYG------------YKGSKFHRVIKDFMIQGGD-IT-----T-G-D-G-----T----G----------------------------GVS---IYGETFPDENFKLKHYGIG-WVSMANA-G----PDTNGSQFFITLTKPTWLD--------G--------K-HVVFGKVIDG-MT---VVHSIELQAT---D-G----H--DRPLTNCSIINS-----------------
17 PsiBlast_PDB 69.5046% -91 - C6 -2ESL PPIC_HUMAN A:[12-174] ----------PSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYG------------YKGSKFHRVIKDFMIQGGD-IT-----T-G-D-G-----T----G----------------------------GVS---IYGETFPDENFKLKHYGIG-WVSMANA-G----PDTNGSQFFITLTKPTWLD--------G--------K-HVVFGKVIDG-MT---VVHSIELQAT---D-G----H--DRPLTNCSIINS-----------------
36 PsiBlast_CBE 69.4645% -84 - C6 -1C5F CYP1_BRUMA I:[21-170] -----------------------GR-----IVMELYNDIAPRTCNNFLMLCTGMA--GTGKISGKPL--HYKGSTFHRVIKNFMIQGGD-FTK--G-D-G-T-G-----G----ESIY-------------------------GGM---FDDE-EFVMKHD-EPF----VVSMANK-G----PNTNGSQFFITTTPAPHLN--------N--------I-HVVFGKVVSG----QEVVTKIEYLKT---N-S----K--NRP-LADVVI-------------------
39 PsiBlast_CBE 69.3645% -86 - C6 -1C5F CYP1_BRUMA C:[21-170] -----------------------GR-----IVMELYNDIAPRTCNNFLMLCTGMA--GTGKISGKPL--HYKGSTFHRVIKNFMIQGGD-FTK--G-D-G-T-G-----G----ESIY-------------------------GGM---FDDE-EFVMKHD-EPF----VVSMANK-G----PNTNGSQFFITTTPAPHLN--------N--------I-HVVFGKVVSG----QEVVTKIEYLKT---N-S----K--NRP-LADVVI-------------------
44 PsiBlast_CBE 68.9545% -81 - C6 -2POY ? B:[30-181] -------------------QTPAGR-----ITMELFADKVPITAENFRALCTGEKG---MGQSGKPL--CYTGSFFHRIIPQFMIQGGD-FTR--G-D-G-T-G-----G----ESIY-------------------------G-K---FRDE-NFVYTHD-APF----LLSMANA-G----PNTNGSQFFITTVPCPWLD--------G--------K-HVVFGKVL---EG-MEVVKSIEKCGS---Q------N--GKP-TKSVCI-------------------
33 PsiBlast_CBE 68.9545% -82 - C6 -1C5F CYP1_BRUMA O:[21-170] -----------------------GR-----IVMELYNDIAPRTCNNFLMLCTGMA--GTGKISGKPL--HYKGSTFHRVIKNFMIQGGD-FTK--G-D-G-T-G-----G----ESIY-------------------------GGM---FDDE-EFVMKHD-EPF----VVSMANK-G----PNTNGSQFFITTTPAPHLN--------N--------I-HVVFGKVVSG----QEVVTKIEYLKT---N-S----K--NRP-LADVVI-------------------
28 PsiBlast_CBE 68.6546% -89 - C6 -2ESL PPIC_HUMAN D:[12-174] ----------PSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYG------------YKGSKFHRVIKDFMIQGGD-IT-----T-G-D-G-----T----G----------------------------GVS---IYGETFPDENFKLKHYGIG-WVSMANA-G----PDTNGSQFFITLTKPTWLD--------G--------K-HVVFGKVIDG-MT---VVHSIELQAT---D-G----H--DRPLTNCSIINS-----------------
41 PsiBlast_CBE 68.3645% -94 - C6 -2CFE ? A:[16-162] -----------------------GT-----IKFKLFDDVVPKTAANFRALCTGEKGFG------------YAGSHFHRVIPDFMLQGGD-FTA--G-N-G-T-G-----G----KSIY-------------------------GAK---FADE-NFQLKHN-KPG----LLSMANA-G----PNTNGSQFFITTVVTSWLD--------G--------K-HVVFGEVIDG----MNVVKAIEAEGS-----G----S--GKP-RSRIEIAKCGVC-------------
35 PsiBlast_CBE 68.3145% -84 - C6 -1C5F CYP1_BRUMA K:[21-170] -----------------------GR-----IVMELYNDIAPRTCNNFLMLCTGMA--GTGKISGKPL--HYKGSTFHRVIKNFMIQGGD-FTK--G-D-G-T-G-----G----ESIY-------------------------GGM---FDDE-EFVMKHD-EPF----VVSMANK-G----PNTNGSQFFITTTPAPHLN--------N--------I-HVVFGKVVSG----QEVVTKIEYLKT---N-S----K--NRP-LADVVI-------------------
38 PsiBlast_CBE 68.1345% -80 - C6 -1C5F CYP1_BRUMA E:[21-170] -----------------------GR-----IVMELYNDIAPRTCNNFLMLCTGMA--GTGKISGKPL--HYKGSTFHRVIKNFMIQGGD-FTK--G-D-G-T-G-----G----ESIY-------------------------GGM---FDDE-EFVMKHD-EPF----VVSMANK-G----PNTNGSQFFITTTPAPHLN--------N--------I-HVVFGKVVSG----QEVVTKIEYLKT---N-S----K--NRP-LADVVI-------------------
37 PsiBlast_CBE 68.0045% -86 - C6 -1C5F CYP1_BRUMA G:[21-170] -----------------------GR-----IVMELYNDIAPRTCNNFLMLCTGMA--GTGKISGKPL--HYKGSTFHRVIKNFMIQGGD-FTK--G-D-G-T-G-----G----ESIY-------------------------GGM---FDDE-EFVMKHD-EPF----VVSMANK-G----PNTNGSQFFITTTPAPHLN--------N--------I-HVVFGKVVSG----QEVVTKIEYLKT---N-S----K--NRP-LADVVI-------------------
20 PsiBlast_PDB 67.7745% -85 - C6 -1C5F CYP1_BRUMA A:[21-170] -----------------------GR-----IVMELYNDIAPRTCNNFLMLCTGMA--GTGKISGKPL--HYKGSTFHRVIKNFMIQGGD-FTK--G-D-G-T-G-----G----ESIY-------------------------GGM---FDDE-EFVMKHD-EPF----VVSMANK-G----PNTNGSQFFITTTPAPHLN--------N--------I-HVVFGKVVSG----QEVVTKIEYLKT---N-S----K--NRP-LADVVI-------------------
42 PsiBlast_CBE 67.6847% -94 - C6 -1H0P CYP5_CAEEL A:[21-162] -----------------------GR-----IVIGLFGKTVPKTATNFIELAKK------------PKGEGYPGSKFHRVIADFMIQGGD-FTR--G-D-G-T-G-----G----RSIY-------------------------GEK---FADE-NFKLKHY-GAG----WLSMANA-G----ADTNGSQFFITTVKTPWLD--------G--------R-HVVFGKIL---EG-MDVVRKIEQTEK---L-P----G--DRP-KQDVII-------------------
61 PsiBlast_CBE 67.6144% -99 - C6 -3K2C CYPH_ENCCU B:[42-172] -----------------------GR-----IVMKLEDDIVPKTAKNFRTLCER------------PKGEGYKGSTFHRIIPGFMVQGGD-YTAHNG-T-GGR-S-----I----Y----------------------------GEK---FPDE-NFELKHT-KEG----ILSMANC-G----AHTNGSQFFITLGKTQWLD--------E--------K-HVVFGEVV---EG-MDVVHKIAKYGS---E--------------------------------------
68 PsiBlast_CBE 67.5940% -96 - C6 -4N1S PPIA_HUMAN A:[18-158] -----------------------GR-----VSFELFADKVPKTAENFRALSTGEKGFG------------YKGSCFHRIIPGFMCQGGD-FT---RHN-G-T-G-----G----KSIY-------------------------GEK---FEDE-NFILKHT-GPG----ILSMANA-G----PNTNGSQFFICTAKTEWLD--------G--------K-HVVFGKV--K-EG-MNIVEAMERFGS---R------N--GKT-SKKITI-------------------
100 PsiBlast_CBE 67.4640%-100 - C6 -2RMB PPIA_HUMAN K:[18-158] -----------------------GR-----VSFELFADKVPKTAENFRALSTGEKGFG------------YKGSCFHRIIPGFMCQGGD-FT---RHN-G-T-G-----G----KSIY-------------------------GEK---FEDE-NFILKHT-GPG----ILSMANA-G----PNTNGSQFFICTAKTEWLD--------G--------K-HVVFGKV--K-EG-MNIVEAMERFGS---R------N--GKT-SKKITI-------------------
47 PsiBlast_CBE 67.3746% -88 - C6 -4JJM ? A:[21-168] -----------------------GR-----IVMELFADVTPRTAENFRALCTGEKGIGK---SGKPL--HYKGSSFHRVIPGFMCQGGD-FTA--G-N-G-T-G-----G----ESIY-------------------------GSK---FADENFVK-KHT-GPG----ILSMANA-G----PGTNGSQFFVCTAKTEWLD--------G--------K-HVVFGQVV---EG-MDVVKAIEKVGS---S------S--GRT-NKPVVI-------------------
62 PsiBlast_CBE 67.0844% -98 - C6 -3K2C CYPH_ENCCU A:[42-172] -----------------------GR-----IVMKLEDDIVPKTAKNFRTLCER------------PKGEGYKGSTFHRIIPGFMVQGGD-YTAHNG-T-GGR-S-----I----Y----------------------------GEK---FPDE-NFELKHT-KEG----ILSMANC-G----AHTNGSQFFITLGKTQWLD--------E--------K-HVVFGEVV---EG-MDVVHKIAKYGS---E--------------------------------------