@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Rv0031: (2016-04-18 )
MLARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKPRCESDVFARIGHTSHPSTRKSRVGPGASEAPLA

Atome Classification :

(20 SA) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------.........10.....----.----..20....---....-30--........40......----------..50.-----.......60........70-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MLARHFGAGRKAHSRA----V----ATLKADIQ---AWHP-AG--IQTPKPRCESDVFARI----------GHTSH-----PSTRKSRVGPGASEAPLA------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
7 PsiBlast_PDB 74.5628% -36 - C6 -1ES6 - VP40_EBOZ5 A:[88-165] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LMKQIP---IWLP-LG--VADQKTYSFDSTTAAIMLASYTITHFGKATN-----PLVRVNRLGPGIPDHPL-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
9 PsiBlast_PDB 73.8828% -34 - C6 -4LDD - VP40_EBOZM B:[88-183] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LMKQIP---IWLP-LG--VADQKTYSFDSTTAAIMLASYTITHF---TN-----PLVRVNRLGPGIPDHPL-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
8 PsiBlast_PDB 73.3628% -34 - C6 -4LDB - VP40_EBOZM A:[88-157] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LMKQIP---IWLP-LG--VADQKTYSFDSTTAAIMLASYTITHFGKATN-----PLVRVNRLGPGIPDHPL-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
10 PsiBlast_PDB 72.5528% -44 - C6 -4LDI - VP40_EBOZM A:[88-170] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LMKQIP---IWLP-LG--VADQKTYSFDSTTAAIMLASYTITHFGKATN-----PLVRVNRLGPGIPDHPL-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
2 PsiBlast_PDB 71.5627% -23 - C6 -4LDM - VP40_EBOZM A:[87-147] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------VLMKQIP---IWLP-LG--VADQKTYSFDSTTAAIMLASYTITHFGKATN-----PLVRVNRLGPGIPDHPL-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
22 Fugue 70.4127% -27 - C4 -2HIN ? A:[1-66] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MKPEELVRHFGDVEKA-AVG----V----GVTPGAVY---QWLQ-AG----EIPPLRQSDIEVRT----------AYKLK-----SDFTSQRMGKEGH-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
1 PsiBlast_PDB 68.9727% -22 - C6 -1H2C VP40_EBOZM A:[33-93] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------VLMKQIP---IWLP-LG--VADQKTYSFDSTTAAIMLASYTITHFGKATN-----PLVRVNRLGPGIPDHPL-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
4 PsiBlast_PDB 68.8133% -35 - C4 -4LNB - ? A:[170-241] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LVRHFKLWD--HPRE----IQDVEALLKADVRNNSAWNH-RY--MLRFGPRDENEFDAGL----------HNTTG-----PSSEKGRL----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
3 PsiBlast_PDB 68.6333% -25 - C4 -4L9P ? A:[170-245] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LVRHFKLWD--HPRE----IQDVEALLKADVRNNSAWNH-RY--MLRFGPRDENEFDAGL----------HNTTG-----PSSEKGRL----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
11 PsiBlast_PDB 68.2228% -17 - C6 -1H2D VP40_EBOZM A:[58-117] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LMKQIP---IWLP-LG--VADQKTYSFDSTTAAIMLASYTITHFGKATN-----PLVRVNRLGPGIPDHPL-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
6 PsiBlast_PDB 68.0533% -29 - C4 -4MBG - ? A:[170-245] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LVRHFKLWD--HPRE----IQDVEALLKADVRNNSAWNH-RY--MLRFGPRDENEFDAGL----------HNTTG-----PSSEKGRL----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
5 PsiBlast_PDB 67.8133% -34 - C4 -4LNG - ? A:[170-245] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LVRHFKLWD--HPRE----IQDVEALLKADVRNNSAWNH-RY--MLRFGPRDENEFDAGL----------HNTTG-----PSSEKGRL----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
25 Fugue 53.0823% -45 - C2 -4Z24 YR135_MIMIV A:[4-652] NLTGDIVIIGAGAAGSLLAHYLARFSNMKIILLEAGHSHFNDPVVTDPMGFFGKYNPPNENISMSQNPSYSWQGAQEPNTGAYGNRPIIAHGMGFGGSTMINRLNLVVGGRTVFDNDWPVGWKYDDVKNYFRRVLVDINPVRDNTKASITSVALDALRIIAEQQIASGEPVDFLLNKATGNVPNVEKTTPDAVPLNLNDYEGVNSVVAFSSFYMGVNQLSDGNYIRKYAGNTYLNRNYVDENGRGIGKFSGLRVVSDAVVDRIIFKGNRAVGVNYIDREGIMHYVKVNKEVVVTSGAFYTPTILQRSGIGDFTYLSSIGVKNLVYNNPLVGTGLKNHYSPVTITRVHGEPSEVSRFLSNMAANPTNMGFKGLAELGFHRLDPNKPANANTVTYRKYQLMMTAGVGIPAEQQYLSGLSPSSNN----L----FTLIADDI---RFAP-EGY-IKIGTPNIPRDV-PKI----------FFNTF-----VTYTPTS-APADQQWPIAQKTLAPLISALLGYDIIYQTLMSMNQTARDSGFQVSLEMVYPLNDLIYKLHNGLATYGANWWHYFVPTLVGDDTPAGREFADTLSKLSYYPRVGAHLDSHQGCSCSIGRTVDSNLKVIGTQNVRVADLSAAAFPPGGNTWATASMIGARAVDLILGFPYLRDLPVNDVPILNVN
31 Fugue 52.7616% -27 - C4 -2IP6 ? A:[7-93] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------EHIKQQALDLFTRLQFLLQKH--DTIEPYQYV----L----DILETGIS---KTKH--N--QQTPERQARV-VYNKI----------ASQALVDKLHFTAEENKVLAAINELAHS------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
28 Fugue 46.6025% -25 - C1 -1UVQ - OREX_HUMAN C:[6-25] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MNL-----PSTKVSWAAVGGGGSLV-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
18 HHSearch 45.1621% 0 - C- -4RKU - ? N:[36-10] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------QFGTCKFPENFTGCQDL----AKQKKVPF---ISEDLELECEGKDKFKCGSNVFWK---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
30 Fugue 43.5917% 3 - C3 -1E68 - ? A:[1-70] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MAKEFGIPAAVAGTV----L----NVVEAGGW---VTTI-VS--ILTAVGSGGLSLLAAA----------GRESI-----KAYLKKEIKKKGKRAVIAW-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------
12 HHSearch 41.7033% -25 - C6 -1H2C VP40_EBOZM A:[67-93] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TITHF----------GKATN-----PLVRVNRLGPGIPDHPL-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
19 HHSearch 41.1931% -22 * C6 *3TCQ - ? A:[122-173] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ITHF----------GKANN-----PLVRVNRLGQGIPDHPL-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
29 Fugue 37.978% -54 * C4 *2K6O - A:[1-37] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LLGDFFRKSKEKIGKE----F----KRIVQRIK---DFLR-NL--VPRTES------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------