@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Rv0036c: (2016-04-18 )
MADPGPFVADLRAESDDLDALVAHLPADRWADPTPAPGWTIAHQIGHLLWTDRVALTAVTDEAGFAELMTAAAANPAGFVDDAATELAAVSPAELLTDWRVTRGRLHEELLAVPDGRKLAWFGPPMSAASMATARLMETWAHGLDVADALGVIRPATQRLRSIAHLGVRTRDYAFIVNNLTPPAEPFLVELRGPSGDTWSWGPSDAAQRVTGSAEDFCFLVTQRRALSTLDVNAVGEDAQRWLTIAQAFAGPPGRGR

Atome Classification :

(20 SA) -----.........10..-......20........30........-40........50..-....-..--60-----.--.---..-.-....70........----------80..--......90........100.......110-.--..-..---.------.--120-.-----..--.--....130...-.---....140.......150..-----.....160.......170.---...--...180........190.......200.......210---....-------...220.......230.......240.......250.....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) -----MADPGPFVADLRA-ESDDLDALVAHLPADRWADPTPAPGW-TIAHQIGHLLWTDR-VALT-AV--T------D--E---AG-F-AELMTAAAANPAGF----------VDDA--ATELAAVSPAELLTDWRVTRGRLHEELLA-V--PD-GR---K------L--A-W-F-----GP--P--MSAASM-ATA-R---LMETWAHGLDVADALGVIR-----PATQRLRSIAHLGVRTRDY---AFI--VNNL-TPPAEPFLVELRGPSGDTWSWGPSDAAQRVTG---SAED-------FCFLVTQRRALSTLDVNAVGEDAQRWLTIAQAFAGPPGRGR
43 Fugue 87.7315% -55 - C4 -2NSF ? A:[21-260] MTTFHDLPLEERLTLARL-GTSHYSRQLSLVDNAEFGEHSLLEGW-TRSHLIAHVAYNAI-ALCN-LM--H------W--A---NT-G-EE---TPMYVSPEA----------RNEE--IAYGSTLNPDALRNLHEHSVARLDVAWRE-T--SE-DA---W------S--H-E-VLTAQ-GR--T--VPASET-LWM-R---SREVWIHAVDLGAVATFGD-----IPEVILRTLAAEITQKWTS--------------QGAGEGLVLLDEPSSTRYPAAPGQDEVVVSG---SLAG-------IVRYAAGRGSDGVTSSTGEVPEPPRW---------------
23 HHSearch 84.4413% -73 * C4 *2NSF ? A:[28-251] -------PLEERLTLARL-GTSHYSRQLSLVDNAEFGEHSLLEGW-TRSHLIAHVAYNAI-ALCN-LM--H------W--ANT-GE-E-TP----MY-VSPEA----------RNEE--IAYGSTLNPDALRNLHEHSVARLDVAWRE-T--SE-DA---WSHE---V--L-T-AQ----GR--T--VPASET-LWM-R---SREVWIHAVDLGAVATFGD-----IPEVILRTLAAEITQK--W---T----SQGA-G---EGLVLLDEP-SSTRYPAAPGQDEVVVSG---SLAG-------IVRYAAGRGS-D--GVTSST---------------------
44 Fugue 75.9620% -76 * C3 *4QT4 - PTH_STRPZ A:[1-189] ----------------------MVKMIVGLGNPGSKYEKT--------KHNIGFMAIDNI-VKNL-DV--T-------------------------------F----------TDD----------------KNFKAQIGSTFI---------N-HE---K------V--Y-F-V-----KP--TTFMNNSGI-AVK-A---LLTYY--NIDITDLIVIYDDLDMEVSKLRLRSKGSAG-GHNGI---KSI--IAHIGTQEFNRIKVGIGRPLKG------MTVINHVMGQFNTEDN-------IAISLTLDRVVNAVKFYLQEND---FEKTMQKFNG------
36 HHSearch 64.1614% -67 - C4 -3DI5 ? A:[3-141] -----YQTIEGFLQSWTY-ETESTQKMLDVLTDESLSQEIAPGHW-TLGRVAWHIVTAIP-VILS-GT--G------L-------K-F-EG----E------T----------------KDYPVPTSAKTIADGYRKVNTAFVEALQSEW--TD-KD---LTTI---N--D-F-F-----GR--P--MPNSIF-LMT-L---INHQNHHRGQMTVLMR-------------------------------------------------------------------------------------------------------------------------------
29 HHSearch 61.9912% -61 - C4 -2RD9 ? A:[22-176] ------FQMNEAIQLLER-TPKTLEVFLEGLSDSWHQCNEGYETW-TVYEVVVHLIEAEKTNWIP-RL--R------FI-LQ--EG-E-HK----PFPAFDRF----------SHL----NQSNAVPISERFKEFQQLRKENLNTLRS-LVQSE-ADLERT------G--A-H-PA----FG--V--VKVREL-LSA-W---VVHDLTHIAQIVRSMAKR-----------------------------------------------------------------------------------------------------------------------------
32 HHSearch 61.829% -69 - C4 -3DKA YJOA_BACSU A:[6-141] ---------NQIVSHFLS-HRNVTNELAEKISKDHYSYKPAETSM-SAEELVKHILTSFH-LFAN-VI--K------E--G---NA-S-------P------F----------Q-------N----TETDLNVLAKTYTEKTVAILEQ-L--TE-EQLDRE------I--D--AF-----GR--K--VTGRAL-LQL-A---MEHEIHHKGNLFVYVR-------------------------------------------------------------------------------------------------------------------------------
35 HHSearch 61.0111% -72 - C4 -3GOR ? A:[4-142] -----MSRAKKWVQYFLS-HRHVTMELIHKIDEAHYDYKPTPTSM-TAKQLATHMLFSFY-NFAN-TA--K------H--G---D--P-S-----L------F----------RQK-------IEEPETNLAKLAETYTEKTRQLIES-M--SD-DDFDRT------LDLT-A-IF----GT--Q--MSTAQF-LQL-A---MDHEIHHKGQLFVYV--------------------------------------------------------------------------------------------------------------------------------
31 HHSearch 60.8814% -66 - C4 -2YQY - ? A:[9-166] -------TWDEALKRLEA-SRKALLALLREADPAWLSAPLREGAW-TPLMVAEHVALVED-STAR-VL--RRLRRLA------------------------------------------------LSLEEVLALLDRARAFLLEEVAK-A---D-PQNPAT------F--PHP-F-----FG--E--LNPLGW-LRA-A---AYHEAHHLKALQAS---------------------------------------------------------------------------------------------------------------------------------
28 HHSearch 59.9011% -62 - C4 -1RXQ YFIT_BACSU A:[23-173] -------QKDKWIQVLEE-VPAKLKQAVEVMTDSQLDTPYRDGGW-TVRQVVHHLADSHM-NSYI-RF--K------L--SL--TE-E-TPAI--RPYDEKAW----------S--E--LKDSKTADPSGSLALLQELHGRWTALLRT-L--TD-QQ---FKRGFY-H--P-D-T-----KE--I--ITLENA-LGL-Y---VWHSHHHIAHITELSR-------------------------------------------------------------------------------------------------------------------------------
34 HHSearch 58.9113% -66 - C4 -2F22 ? A:[4-127] ------------TNGVLY-AANMTNALAKEIPESKWDIQLIPELG-TLRKLFIHIVRVRD-VYRD-GL--K------T--G---S--I-------KF----------------PG-------RLASDEHRLLDELERSMEELVFEFKQ-T--TF-NS----------I--K-M-G-----EN--Y--LSIMEL-LGT-V---IQHEGIHQGQYYVAL--------------------------------------------------------------------------------------------------------------------------------
25 HHSearch 58.888% -56 - C4 -5COG IRC4_YEAST A:[18-178] -------SKKELKEEIEK-KYEKYDAEFETISESQKDEKVETVDR-TPSENLSYQLGWVN-LLLE-WE--AKEIA--G--Y---NV-E-TPAPGYKWNNLGGL----------YQSF--YKKYGIYSIKEQRAKLREAVNEVYKWIST-L--SD-DE---LFQAGN-R--K-W-A-----TTKAM--WPVYKW-IHINT---VAPFTNFRGKIRKWKR-------------------------------------------------------------------------------------------------------------------------------
37 HHSearch 56.0914% -43 - C4 -2OU6 ? A:[33-179] -------HIGALVEMLTY-ARLTTLQAVEGLPEDQLWATAPGFAN-SIGTLLAHIAAVER-VYHVLSF--Q------G--R---DV-T-PEDDGAAYWGLT-M----------GKEG--TAPARLPTLDELRAELADARAETLRVFAA-K--DD-AW---L------AE-P-L-G-----PG--W--ANQHWA-WFH-V---MEDEVNHRGQLRL----------------------------------------------------------------------------------------------------------------------------------
39 HHSearch 55.4714% -58 - C4 -2QNL ? A:[11-158] ---------RLALDAWNT-QSSRTDKLIQSLSNEALAVETAPGRN-SGTYLLGHLTAVHD-AMLPLLE--L------G--D---TL-Y-P-QL--A--PVFIQ----------NPD---KSGLEKPEINDLRLYWSLVQERLANQFNQ-L--QP-AD---WFNKHAAI--S-RED-----FL--K--EPHRNK-LSV-LINRTNHMAYHLGQLA-----------------------------------------------------------------------------------------------------------------------------------
40 HHSearch 52.8015% -60 - C4 -2HKV ? A:[2-136] -----MTDWQQALDRHVGVGVRTTRDLIRLIQPEDWDKRPISGKR-SVYEVAVHLAVLLE--ADL-RIA-T------G--A---TA-D-E---------MAQF------------------YAVPVLPEQLVDRLDQSWQYYQDRLMA-D---F-ST---E------T--T-Y-W-----GV--T--DSTTGW-LLE-A---AVHLYHHRSQLLDYL--------------------------------------------------------------------------------------------------------------------------------
41 HHSearch 49.9113% -51 - C4 -4X8E EGTB_MYCTH A:[9-147] -------HRAELARQLID-ARNRTLRLV-DFDDAELRRQYDPLMS-PLVWDLAHIGQQEE-LWLL-RGGDP------R--R---PG-LLEPAVE-QL--YDAF----------VHPRASRVHLPLLSPAQARRFCATVRSAVLDALDR-L--PE---------------------------------DADTFA-FGM-V---VSHEHQHDETMLQAL--------------------------------------------------------------------------------------------------------------------------------
46 Fugue 49.7510% -38 - C4 -3DKA YJOA_BACSU A:[6-154] ---------NQIVSHFLS-HRNVTNELAEKISKDHY-SYKPAETSMSAEELVKHILTSFH-LFAN-VI--K------EGNA---SP-F-QNTETDLNVLAKTY----------TEKT--VAILEQLTEEQLDREIDAFGRKVTGRALL-Q--LAMEH---E------I--H-H-K-----GN--L--FVYVREMGHT-E---LPFYQQR----------------------------------------------------------------------------------------------------------------------------------------
26 HHSearch 48.957% -46 - C4 -4N6C ? A:[16-178] ------ENKEELKAEIEK-TFEKYILEFDNIPENLKDKRADEVDR-TPAENLAYQVGWTN-LVLK-WE--E------DE-RKGLQV-K-TPSDKFKWNQLGEL----------YQWF--TDTYAHLSLQELKAKLNENINSISAMIDS-L--SE-EE---LFEP---HMRK-W-ADEATKTA--T--WEVYKF-IHVNT---VAPFGTFRTKIRKW---------------------------------------------------------------------------------------------------------------------------------
30 HHSearch 48.789% -60 - C4 -3CEX ? A:[4-163] -----MKVTQLSSETLDR-AHERFEETLAQMTVAEANTMPAPLIK-SVTWLMWHTARELD-LQIS-AL--N------H--S---DPLW-LSQH--WTEKFALDLPDETEDWHHTPEE--AAKVVVAEKQLLSDYLAASVALTKSYLDQ-I--KE-EQLSDV------IDKN-W-------TP--P--VTRQVR-LVS-A---IDDAVMHSGQAV-----------------------------------------------------------------------------------------------------------------------------------
1 PsiBlast_PDB 47.2722% -63 - C2 -4M8K ? A:[42-160] ----------------------------------------------------------------------------------------------------------------------------------------------------------------N------L--C-W-Y-----GV--P--GEKKEN-DVT-K---VEETWWYRFIHEHGFQLER-----NNSYSGSTVCHTGYEKADYSDRSFITRIHNL-GTPD---IILVFGGTNDSWAGAPIGAYQYDGW---TKADLYSFRPAFCYLLASLKQL------------------------------
33 HHSearch 45.949% -52 - C4 -2QE9 YIZA_BACSU A:[19-155] -------GMMKFFEYNWQ-VRDQWFTWCHQLTTEELLKNRLGGVE-NILYTLFHIIDVEY-SWIR-AI--Q------G--K---ED-I----------AVQ--------------------FADYQTLNKVKSLSNTFRTEIIDVLQT-H-------E--L------VSVP-W-ET----GV--L--YTRDEI-LHH-I---IAHEIHHIGQLSVWA--------------------------------------------------------------------------------------------------------------------------------