@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Rv0331: (2016-04-21 )
MSKTVLILGAGVGGLTTADTLRQLLPPEDRIILVDRSFDGTLGLSLLWVLRGWRRPDDVRVRPTAASLPGVEMVTATVAHIDIAAQVVHTDNSVIGYDALVIALGAALNTDAVPGLSDALDADVAGQFYTLDGAAELRAKVEALEHGRIAVAIAGVPFKCPAAPFEAAFLIAAQLGDRYATGTVQIDTFTPDPLPMPVAGPEVGEALVSMLKDHGVGFHPRKALARVDEAARTMHFGDGTSEPFDLLAVVPPHVPSAAARSAGLSESGWIPVDPRTLSTSADNVWAIGDATVLTLPNGKPLPKAAVFAEAQAAVVAHGVARHLGYDVAERHFTGTGACYVETGDHQAAKGDGDFFAPSAPSVTLYPPSREFHEEKVAQELAWLTRWKT

Atome Classification :

(20 SA) .........10........20........30........40........50........60-.....-.-...--70........80.....-...90--.--.-----....--...100.......110.......120.......130.......140..--.-....150...------------------...-------------------..--------------------160.......170.......180.-......-190.....---..200....---...210.......220.......230..--.....240-------.......250.-----......260..---.-.---....270......-.-280.......290---........----300.......310.......320.......330-.......340..-.....350.......360.......370.......380......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MSKTVLILGAGVGGLTTADTLRQLLPPEDRIILVDRSFDGTLGLSLLWVLRGWRRPDDVR--VRPTA-A-SLP--GVEMVTATVAHIDIAAQ-VVHT---D--N-----SVIG--YDALVIALGAALNTDAVPGLSDALDADVAGQFYTLDGAAELRAKVEAL--E-HGRIAV-AIA------------------GVP-------------------FK--------------------CPAAPFEAAFLIAAQLGDRYATGT-VQIDTF-TPDPLPMP---VAGPEVGEA---LVSMLKDHGVGFHPRKALARVDEAARTM--HFGDGTSE-------PFDLLAVVPPH-----VPSAAARS-AG---L-S---ESGWIPVDPRTLS-T-SADNVWAIGDAT----VLTLPNGK----PLPKAAVFAEAQAAVVAHGVARHLGYDVAERHF-TGTGACYVETGD-HQAAKGDGDFFAPSAPSVTLYPPSREFHEEKVAQELAWLTRWKT
14 PsiBlast_PDB 91.3426% -91 - C2 -3SYI SQRD_ACIF2 A:[4-406] -SAHVVILGAGTGGMPAAYEMKEALGSGHEVTLISANDYFQFVPSNPWVGVGWKERDDIAFPIR-HY-V-ERK--GIHFIAQSAEQIDAEAQNITLA---D--G-----NTVH--YDYLMIATGPKLAFENVPG-SDPHEGPVQA-ICTVDHAERAFAEYQALLRE-PGPIVIGAMA------------------GA---------------------S--------------------CFGPAYEYAMIVASDLKKRGMRDK-IPSFTFITSEPYIGH---LGIQGVGDSKGILTKGLKEEGIEAYTNCKVTKVEDNKMYV--TQVDEKGETIKEMVLPVKFGMMIPAFKG---VPAVAGVE-GL---C-N---PGGFVLVDEHQRS-K-KYANIFAAGIAIAIPPVETTPVPT----GAPKTGYMIESMVSAAVHNIKADLEGRKGEQTMGTWNAVCFADMGD-RGAAFIALPQLKPRKVDVFAY--GRWVHLAKVAFEKYFIRKMK-
13 PsiBlast_PDB 90.8926% -88 - C2 -3SY4 SQRD_ACIF2 A:[4-406] -SAHVVILGAGTGGMPAAYEMKEALGSGHEVTLISANDYFQFVPSNPWVGVGWKERDDIAFPIR-HY-V-ERK--GIHFIAQSAEQIDAEAQNITLA---D--G-----NTVH--YDYLMIATGPKLAFENVPG-SDPHEGPVQA-ICTVDHAERAFAEYQALLRE-PGPIVIGAMA------------------GA---------------------S--------------------CFGPAYEYAMIVASDLKKRGMRDK-IPSFTFITSEPYIGH---LGIQGVGDSKGILTKGLKEEGIEAYTNCKVTKVEDNKMYV--TQVDEKGETIKEMVLPVKFGMMIPAFKG---VPAVAGVE-GL---C-N---PGGFVLVDEHQRS-K-KYANIFAAGIAIAIPPVETTPVPT----GAPKTGYMIESMVSAAVHNIKADLEGRKGEQTMGTWNAVCFADMGD-RGAAFIALPQLKPRKVDVFAY--GRWVHLAKVAFEKYFIRKMK-
16 PsiBlast_PDB 89.6126% -89 - C2 -3T14 SQRD_ACIF2 A:[4-406] -SAHVVILGAGTGGMPAAYEMKEALGSGHEVTLISANDYFQFVPSNPWVGVGWKERDDIAFPIR-HY-V-ERK--GIHFIAQSAEQIDAEAQNITLA---D--G-----NTVH--YDYLMIATGPKLAFENVPG-SDPHEGPVQ-SIATVDHAERAFAEYQALLRE-PGPIVIGAMA------------------GA---------------------S--------------------CFGPAYEYAMIVASDLKKRGMRDK-IPSFTFITSEPYIGH---LGIQGVGDSKGILTKGLKEEGIEAYTNCKVTKVEDNKMYV--TQVDEKGETIKEMVLPVKFGMMIPAFKG---VPAVAGVE-GL---C-N---PGGFVLVDEHQRS-K-KYANIFAAGIAIAIPPVETTPVPT----GAPKTGYMIESMVSAAVHNIKADLEGRKGEQTMGTWNAVCFADMGD-RGAAFIALPQLKPRKVDVFAY--GRWVHLAKVAFEKYFIRKMK-
19 PsiBlast_PDB 89.5626% -90 - C2 -3SX6 SQRD_ACIF2 A:[4-406] -SAHVVILGAGTGGMPAAYEMKEALGSGHEVTLISANDYFQFVPSNPWVGVGWKERDDIAFPIR-HY-V-ERK--GIHFIAQSAEQIDAEAQNITLA---D--G-----NTVH--YDYLMIATGPKLAFENVPG-SDPHEGPVQ-SICTVDHAERAFAEYQALLRE-PGPIVIGAMA------------------GA---------------------S--------------------CFGPAYEYAMIVASDLKKRGMRDK-IPSFTFITSEPYIGH---LGIQGVGDSKGILTKGLKEEGIEAYTNCKVTKVEDNKMYV--TQVDEKGETIKEMVLPVKFGMMIPAFKG---VPAVAGVE-GL---C-N---PGGFVLVDEHQRS-K-KYANIFAAGIAIAIPPVETTPVPT----GAPKTGYMIESMVSAAVHNIKADLEGRKGEQTMGTWNAVAFADMGD-RGAAFIALPQLKPRKVDVFAY--GRWVHLAKVAFEKYFIRKMK-
11 PsiBlast_PDB 89.2326% -94 - C2 -3SZC SQRD_ACIF2 A:[4-406] -SAHVVILGAGTGGMPAAYEMKEALGSGHEVTLISANDYFQFVPSNPWVGVGWKERDDIAFPIR-HY-V-ERK--GIHFIAQSAEQIDAEAQNITLA---D--G-----NTVH--YDYLMIATGPKLAFENVPG-SDPHEGPVQ-SICTVDHAERAFAEYQALLRE-PGPIVIGAMA------------------GA---------------------S--------------------CFGPAYEYAMIVASDLKKRGMRDK-IPSFTFITSEPYIGH---LGIQGVGDSKGILTKGLKEEGIEAYTNCKVTKVEDNKMYV--TQVDEKGETIKEMVLPVKFGMMIPAFKG---VPAVAGVE-GL---C-N---PGGFVLVDEHQRS-K-KYANIFAAGIAIAIPPVETTPVPT----GAPKTGYMIESMVSAAVHNIKADLEGRKGEQTMGTWNAVCFADMGD-RGAAFIALPQLKPRKVDVFAY--GRWVHLAKVAFEKYFIRKMK-
17 PsiBlast_PDB 89.1526% -89 - C2 -3T2K SQRD_ACIF2 A:[4-406] -SAHVVILGAGTGGMPAAYEMKEALGSGHEVTLISANDYFQFVPSNPWVGVGWKERDDIAFPIR-HY-V-ERK--GIHFIAQSAEQIDAEAQNITLA---D--G-----NTVH--YDYLMIATGPKLAFENVPG-SDPHEGPVQ-SIATVDHAERAFAEYQALLRE-PGPIVIGAMA------------------GA---------------------S--------------------CFGPAYEYAMIVASDLKKRGMRDK-IPSFTFITSEPYIGH---LGIQGVGDSKGILTKGLKEEGIEAYTNCKVTKVEDNKMYV--TQVDEKGETIKEMVLPVKFGMMIPAFKG---VPAVAGVE-GL---C-N---PGGFVLVDEHQRS-K-KYANIFAAGIAIAIPPVETTPVPT----GAPKTGYMIESMVSAAVHNIKADLEGRKGEQTMGTWNAVCFADMGD-RGAAFIALPQLKPRKVDVFAY--GRWVHLAKVAFEKYFIRKMK-
18 PsiBlast_PDB 88.7526% -94 - C2 -3KPK SQRD_ACIF2 A:[4-403] ----VVILGAGTGGMPAAYEMKEALGSGHEVTLISANDYFQFVPSNPWVGVGWKERDDIAFPIR-HY-V-ERK--GIHFIAQSAEQIDAEAQNITLA---D--G-----NTVH--YDYLMIATGPKLAFENVPG-SDPHEGPVQ-SICTVDHAERAFAEYQALLRE-PGPIVIGAMA------------------GAS-------------------AF--------------------GPA--YEYAMIVASDLKKRGMRDK-IPSFTFITSEPYIGH---LGIQGVGDSKGILTKGLKEEGIEAYTNCKVTKVEDNKMYV--TQVDEKGETIKEMVLPVKFGMMIPAFKG---VPAVAGVE-GL---C-N---PGGFVLVDEHQRS-K-KYANIFAAGIAIAIPPVETTPVPT----GAPKTGYMIESMVSAAVHNIKADLEGRKGEQTMGTWNAVCFADMGD-RGAAFIALPQLKPRKVDVFAY--GRWVHLAKVAFEKYFIRKMK-
9 PsiBlast_PDB 88.4026% -91 - C2 -3T31 SQRD_ACIF2 A:[4-406] -SAHVVILGAGTGGMPAAYEMKEALGSGHEVTLISANDYFQFVPSNPWVGVGWKERDDIAFPIR-HY-V-ERK--GIHFIAQSAEQIDAEAQNITLA---D--G-----NTVH--YDYLMIATGPKLAFENVPG-SDPHEGPVQ-SICTVDHAERAFAEYQALLRE-PGPIVIGAMA------------------GA---------------------S--------------------CFGPAYEYAMIVASDLKKRGMRDK-IPSFTFITSEPYIGH---LGIQGVGDSKGILTKGLKEEGIEAYTNCKVTKVEDNKMYV--TQVDEKGETIKEMVLPVKFGMMIPAFKG---VPAVAGVE-GL---C-N---PGGFVLVDEHQRS-K-KYANIFAAGIAIAIPPVETTPVPT----GAPKTGYMIESMVSAAVHNIKADLEGRKGEQTMGTWNAVCFADMGD-RGAAFIALPQLKPRKVDVFAY--GRWVHLAKVAFEKYFIRKMK-
15 PsiBlast_PDB 88.1026% -89 - C2 -3SXI SQRD_ACIF2 A:[4-406] -SAHVVILGAGTGGMPAAYEMKEALGSGHEVTLISANDYFQFVPSNPWVGVGWKERDDIAFPIR-HY-V-ERK--GIHFIAQSAEQIDAEAQNITLA---D--G-----NTVH--YDYLMIATGPKLAFENVPG-SDPHEGPVQ-SIATVDHAERAFAEYQALLRE-PGPIVIGAMA------------------GA---------------------S--------------------CFGPAYEYAMIVASDLKKRGMRDK-IPSFTFITSEPYIGH---LGIQGVGDSKGILTKGLKEEGIEAYTNCKVTKVEDNKMYV--TQVDEKGETIKEMVLPVKFGMMIPAFKG---VPAVAGVE-GL---C-N---PGGFVLVDEHQRS-K-KYANIFAAGIAIAIPPVETTPVPT----GAPKTGYMIESMVSAAVHNIKADLEGRKGEQTMGTWNAVCFADMGD-RGAAFIALPQLKPRKVDVFAY--GRWVHLAKVAFEKYFIRKMK-
48 Fugue 88.0424%-113 - C2 -3H8L SQRD_ACIAM A:[2-357] --TKVLVLGGRFGALTAAYTLKRLVGSKADVKVINKSRFSYFRPALPHVAIGVRDVDELK--VDLSE-ALPEK--GIQFQEGTVEKIDAKSS-MVYY---T--KPDGSMAEEE--YDYVIVGIGAHLATELVKGWDKYGYSV-----CEPEFATKLREKLESF--Q-GGNIAI-GSGPFYQGHNPKPKVPENFVPNAD-------------------SA--------------------CEGPVFEMSLMLHGYFKKKGMLDK-VHVTVF-SPGEY-LS---DLSPNSRKA---VASIYNQLGIKLVHNFKIKEIRE--HEI--VDEKGNTI-------PADITILLPPY-----TGNPALKN-ST---P-DLVDDGGFIPTDLNMVS-I-KYDNVYAVGDAN----SM----------TVPKLGYLAVMTGRIAAQHLANRLGVPTKVDKY-YPTIVC----------------------VADNPYE----------------------
27 HHSearch 87.9523%-112 - C2 -3H8L SQRD_ACIAM A:[2-357] --TKVLVLGGRFGALTAAYTLKRLVGSKADVKVINKSRFSYFRPALPHVAIGVRDVDELK--VDLSEAL-PEK--GIQFQEGTVEKIDAKSS-MVYY---TKPDGSM--AEEE--YDYVIVGIGAHLATELVKGWDKY-G----YSVCEPEFATKLREKLESF--Q-GGNIAI--GS------------------GPFYQGHNPKPKVPENFVPNADSA--------------------CEGPVFEMSLMLHGYFKKKGMLDK-VHVTVF-SPGE-YLS---DLSPNSRKA---VASIYNQLGIKLVHNFKIKEIRE--HEI--VDEKGNTI-------PADITILLPPY-----TGNPALKN-STPD-LVD---DGGFIPTDL-NMVSI-KYDNVYAVGDAN----SMTV----------PKLGYLAVMTGRIAAQHLANRLGVPTKVDKY-YPTIVCVADNPYE--------------------------------------------
10 PsiBlast_PDB 87.8726% -88 - C2 -3SZ0 SQRD_ACIF2 A:[4-406] -SAHVVILGAGTGGMPAAYEMKEALGSGHEVTLISANDYFQFVPSNPWVGVGWKERDDIAFPIR-HY-V-ERK--GIHFIAQSAEQIDAEAQNITLA---D--G-----NTVH--YDYLMIATGPKLAFENVPG-SDPHEGPVQ-SICTVDHAERAFAEYQALLRE-PGPIVIGAMA------------------GA---------------------S--------------------CFGPAYEYAMIVASDLKKRGMRDK-IPSFTFITSEPYIGH---LGIQGVGDSKGILTKGLKEEGIEAYTNCKVTKVEDNKMYV--TQVDEKGETIKEMVLPVKFGMMIPAFKG---VPAVAGVE-GL---C-N---PGGFVLVDEHQRS-K-KYANIFAAGIAIAIPPVETTPVPT----GAPKTGYMIESMVSAAVHNIKADLEGRKGEQTMGTWNAVCFADMGD-RGAAFIALPQLKPRKVDVFAY--GRWVHLAKVAFEKYFIRKMK-