@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Rv0334: (2016-04-21 )
MRGIILAGGSGTRLYPITMGISKQLLPVYDKPMIYYPLTTLMMAGIRDIQLITTPHDAPGFHRLLGDGAHLGVNISYATQDQPDGLAQAFVIGANHIGADSVALVLGDNIFYGPGLGTSLKRFQSISGGAIFAYWVANPSAYGVVEFGAEGMALSLEEKPVTPKSNYAVPGLYFYDNDVIEIARGLKKSARGEYEITEVNQVYLNQGRLAVEVLARGTAWLDTGTFDSLLDAADFVRTLERRQGLKVSIPEEVAWRMGWIDDEQLVQRARALVKSGYGNYLLELLERN

Atome Classification :

(84 SA) .........10........20........30........40........50........60........70........80........90........100.......110.......120.-..-.-....130........140.......150.......160.......170.......180.......190.......200.......210.......220.......230.......240.......250.......260.......270.......280......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MRGIILAGGSGTRLYPITMGISKQLLPVYDKPMIYYPLTTLMMAGIRDIQLITTPHDAPGFHRLLGDGAHLGVNISYATQDQPDGLAQAFVIGANHIGADSVALVLGDNIFYGPGLGTSL-KR-FQ-S-ISGGA-IFAYWVANPSAYGVVEFGAEGMALSLEEKPVTPKSNYAVPGLYFYDNDVIEIARGLKKSARGEYEITEVNQVYLNQGRLAVEVLARGTAWLDTGTFDSLLDAADFVRTLERRQGLKVSIPEEVAWRMGWIDDEQLVQRARALVKSGYGNYLLELLERN
30 PsiBlast_CBE 97.3961%-132 - C1 -5IDT ? B:[13-298] -KGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGMRDVLVISTPQDTPRFQQLLGDGSQWGMNLQYAVQPSPDGLAQAFIIGEQFIGNAPSALVLGDNIYYGHDFQPLL-KA-AD-A-QSSGATVFAYHVHDPERYGVVQFNAQGQAVSIEEKPKAPKSNYAVTGLYFYDQQVVDIAKAVKPSARGELEITSVNQAYMQQGQLNVQTMGRGYAWLDTGTHDSLLDASQFIATLENRQGLKVACPEEIAWRSGWINASQLEALVQPLTKNGYGQYLMQILK--
29 PsiBlast_CBE 96.8161%-129 - C1 -5IDT ? D:[13-298] -KGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGMRDVLVISTPQDTPRFQQLLGDGSQWGMNLQYAVQPSPDGLAQAFIIGEQFIGNAPSALVLGDNIYYGHDFQPLL-KA-AD-A-QSSGATVFAYHVHDPERYGVVQFNAQGQAVSIEEKPKAPKSNYAVTGLYFYDQQVVDIAKAVKPSARGELEITSVNQAYMQQGQLNVQTMGRGYAWLDTGTHDSLLDASQFIATLENRQGLKVACPEEIAWRSGWINASQLEALVQPLTKNGYGQYLMQILK--
5 PsiBlast_PDB 95.7061%-128 - C1 -5IDT ? A:[13-298] -KGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGMRDVLVISTPQDTPRFQQLLGDGSQWGMNLQYAVQPSPDGLAQAFIIGEQFIGNAPSALVLGDNIYYGHDFQPLL-KA-AD-A-QSSGATVFAYHVHDPERYGVVQFNAQGQAVSIEEKPKAPKSNYAVTGLYFYDQQVVDIAKAVKPSARGELEITSVNQAYMQQGQLNVQTMGRGYAWLDTGTHDSLLDASQFIATLENRQGLKVACPEEIAWRSGWINASQLEALVQPLTKNGYGQYLMQILK--
56 PsiBlast_CBE 95.4659%-126 - C1 -4HO5 ? B:[1-289] MKGIILSGGSGTRLYPLTKVVSKQLLPVYDKPMVYYPLSVLMLAGIKDILIISTPEDTPRFEQLLGGGSELGISLSYAVQSSPDGLAQAFIIGEEFIGDDNVALVLGDNIFYGHGFTELL-QR-AA-NRKSGAT-IFGYNVKDPQRFGVVEFDEKGKVISIEEKPEEPKSSYAVTGLYFYDNRVVDIAKNITPSARGELEITDVNKAYLELGELHVELLGRGFAWLDTGTHESLLQASQFIETIEKRQSLKVACLEEIAYRMGYISREQLIKLAEPLMKNEYGQYLMNLAHRS
57 PsiBlast_CBE 95.4259%-127 - C1 -4HO4 ? B:[1-289] MKGIILSGGSGTRLYPLTKVVSKQLLPVYDKPMVYYPLSVLMLAGIKDILIISTPEDTPRFEQLLGGGSELGISLSYAVQSSPDGLAQAFIIGEEFIGDDNVALVLGDNIFYGHGFTELL-QR-AA-NRKSGAT-IFGYNVKDPQRFGVVEFDEKGKVISIEEKPEEPKSSYAVTGLYFYDNRVVDIAKNITPSARGELEITDVNKAYLELGELHVELLGRGFAWLDTGTHESLLQASQFIETIEKRQSLKVACLEEIAYRMGYISREQLIKLAEPLMKNEYGQYLMNLAHRS
4 PsiBlast_PDB 94.5861%-129 - C1 -5IDS - ? A:[5-290] -KGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGMRDVLVISTPQDTPRFQQLLGDGSQWGMNLQYAVQPSPDGLAQAFIIGEQFIGNAPSALVLGDNIYYGHDFQPLL-KA-AD-A-QSSGATVFAYHVHDPERYGVVQFNAQGQAVSIEEKPKAPKSNYAVTGLYFYDQQVVDIAKAVKPSARGELEITSVNQAYMQQGQLNVQTMGRGYAWLDTGTHDSLLDASQFIATLENRQGLKVACPEEIAWRSGWINASQLEALVQPLTKNGYGQYLMQILK--
13 PsiBlast_PDB 94.0459%-127 - C1 -4HO0 ? A:[1-288] MKGIILSGGSGTRLYPLTKVVSKQLLPVYDKPMVYYPLSVLMLAGIKDILIISTPEDTPRFEQLLGGGSELGISLSYAVQSSPDGLAQAFIIGEEFIGDDNVALVLGDNIFYGHGFTELL-QR-AA-NRKSGAT-IFGYNVKDPQRFGVVEFD---KVISIEEKPEEPKSSYAVTGLYFYDNRVVDIAKNITPSARGELEITDVNKAYLELGELHVELLGRGFAWLDTGTHESLLQASQFIETIEKRQSLKVACLEEIAYRMGYISREQLIKLAEPLMKNEYGQYLMNLAHR-
50 PsiBlast_CBE 93.6859%-126 - C1 -4HOC ? B:[1-288] MKGIILSGGSGTRLYPLTKVVSKQLLPVYDKPMVYYPLSVLMLAGIKDILIISTPEDTPRFEQLLGGGSELGISLSYAVQSSPDGLAQAFIIGEEFIGDDNVALVLGDNIFYGHGFTELL-QR-AA-NRKSGAT-IFGYNVKDPQRFGVVEFDEKGKVISIEEKPEEPKSSYAVTGLYFYDNRVVDIAKNITPSA--ELEITDVNKAYLELGELHVELLGRGFAWLDTGTHESLLQASQFIETIEKRQSLKVACLEEIAYRMGYISREQLIKLAEPLMKNEYGQYLMNLAHR-
36 PsiBlast_CBE 93.4960%-131 - C1 -3PKP RMLA_SALTY L:[5-290] -KGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGSQWGLNLQYKVSPSPDGLAQAFIIGEEFIGHDDCALVLGDNIFYGHDLPKLM-EAAVN-K-ESGAT-VFAYHVNDPERYGVVEFDQKGTAVSLEEKPLQPKSNYAVTGLYFYDNSVVEMAKNLK-----ELEITDINRIYMEQGRLSVAMMGRGYAWLDTGTHQSLIEASNFIATIEERQGLKVSCPEEIAFRKNFINAQQVIELAGPLSKNDYGKYLLKMVK--
38 PsiBlast_CBE 93.4660%-127 - C1 -3PKP RMLA_SALTY J:[5-290] -KGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGSQWGLNLQYKVSPSPDGLAQAFIIGEEFIGHDDCALVLGDNIFYGHDLPKLM-EAAVN-K-ESGAT-VFAYHVNDPERYGVVEFDQKGTAVSLEEKPLQPKSNYAVTGLYFYDNSVVEMAKNLKPSARGELEITDINRIYMEQGRLSVAMMGRGYAWLDTGTHQSLIEASNFIATIEERQGLKVSCPEEIAFRKNFINAQQVIELAGPLSKNDYGKYLLKMVK--
16 PsiBlast_PDB 93.3159%-123 - C1 -4HO4 ? A:[1-289] MKGIILSGGSGTRLYPLTKVVSKQLLPVYDKPMVYYPLSVLMLAGIKDILIISTPEDTPRFEQLLGGGSELGISLSYAVQSSPDGLAQAFIIGEEFIGDDNVALVLGDNIFYGHGFTELL-QR-AA-NRKSGAT-IFGYNVKDPQRFGVVEFDEKGKVISIEEKPEEPKSSYAVTGLYFYDNRVVDIAKNITPSARGELEITDVNKAYLELGELHVELLGRGFAWLDTGTHESLLQASQFIETIEKRQSLKVACLEEIAYRMGYISREQLIKLAEPLMKNEYGQYLMNLAHRS
8 PsiBlast_PDB 93.1760%-129 - C1 -3PKP RMLA_SALTY A:[5-290] -KGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGSQWGLNLQYKVSPSPDGLAQAFIIGEEFIGHDDCALVLGDNIFYGHDLPKLM-EAAVN-K-ESGAT-VFAYHVNDPERYGVVEFDQKGTAVSLEEKPLQPKSNYAVTGLYFYDNSVVEMAKNLKPSARGELEITDINRIYMEQGRLSVAMMGRGYAWLDTGTHQSLIEASNFIATIEERQGLKVSCPEEIAFRKNFINAQQVIELAGPLSKNDYGKYLLKMVK--
54 PsiBlast_CBE 93.1459%-123 - C1 -4HO8 ? C:[1-288] MKGIILSGGSGTRLYPLTKVVSKQLLPVYDKPMVYYPLSVLMLAGIKDILIISTPEDTPRFEQLLGGGSELGISLSYAVQSSPDGLAQAFIIGEEFIGDDNVALVLGDNIFYGHGFTELL-QR-AA-NRKSGAT-IFGYNVKDPQRFGVVEFDEKGKVISIEEKPEEPKSSYAVTGLYFYDNRVVDIAKNITPSARGELEITDVNKAYLELGELHVELLGRGFAWLDTGTHESLLQASQFIETIEKRQSLKVACLEEIAYRMGYISREQLIKLAEPLMKNEYGQYLMNLAHR-
20 PsiBlast_PDB 93.1459%-124 - C1 -4HO9 ? A:[1-289] MKGIILSGGSGTRLYPLTKVVSKQLLPVYDKPMVYYPLSVLMLAGIKDILIISTPEDTPRFEQLLGGGSELGISLSYAVQSSPDGLAQAFIIGEEFIGDDNVALVLGDNIFYGHGFTELL-QR-AA-NRKSGAT-IFGYNVKDPQRFGVVEFDEKGKVISIEEKPEEPKSSYAVTGLYFYDNRVVDIAKNITPSARGELEITDVNKAYLELGELHVELLGRGFAWLDTGTHESLLQASQFIETIEKRQSLKVACLEEIAYRMGYISREQLIKLAEPLMKNEYGQYLMNLAHRS
73 PsiBlast_CBE 93.1262%-122 - C1 -4B4B ? A:[14-298] -KGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDTPRFQQLLGDGSNWGLDLQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHDFHELLGSA-SQ-R-QTGAS-VFAYHVLDPERYGVVEFDQGGKAISLEEKPLEPKSNYAVTGLYFYDQQVVDIARDLKPSPRGELEITDVNRAYLERGQLSVEIMGRGYAWLDTGTHDSLLEAGQFIATLENRQGLKVACPEEIAYRQKWIDAAQLEKLAAPLAKNGYGQYLKRLL---
41 PsiBlast_CBE 93.0860%-133 - C1 -3PKP RMLA_SALTY C:[5-290] -KGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGSQWGLNLQYKVSPSPDGLAQAFIIGEEFIGHDDCALVLGDNIFYGHDLPKLM-EAAVN-K-ESGAT-VFAYHVNDPERYGVVEFDQKGTAVSLEEKPLQPKSNYAVTGLYFYDNSVVEMAKNL------ELEITDINRIYMEQGRLSVAMMGRGYAWLDTGTHQSLIEASNFIATIEERQGLKVSCPEEIAFRKNFINAQQVIELAGPLSKNDYGKYLLKMVK--
18 PsiBlast_PDB 93.0759%-121 - C1 -4HO6 ? A:[1-288] MKGIILSGGSGTRLYPLTKVVSKQLLPVYDKPMVYYPLSVLMLAGIKDILIISTPEDTPRFEQLLGGGSELGISLSYAVQSSPDGLAQAFIIGEEFIGDDNVALVLGDNIFYGHGFTELL-QR-AA-NRKSGAT-IFGYNVKDPQRFGVVEFDEKGKVISIEEKPEEPKSSYAVTGLYFYDNRVVDIAKNITPSARGELEITDVNKAYLELGELHVELLGRGFAWLDTGTHESLLQASQFIETIEKRQSLKVACLEEIAYRMGYISREQLIKLAEPLMKNEYGQYLMNLAHR-
85 PsiBlast_CBE 93.0662%-123 - C1 -4B2X ? A:[14-298] -KGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDTPRFQQLLGDGSNWGLDLQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHDFHELLGSA-SQ-R-QTGAS-VFAYHVLDPERYGVVEFDQGGKAISLEEKPLEPKSNYAVTGLYFYDQQVVDIARDLKPSPRGELEITDVNRAYLERGQLSVEIMGRGYAWLDTGTHDSLLEAGQFIATLENRQGLKVACPEEIAYRQKWIDAAQLEKLAAPLAKNGYGQYLKRLL---
105 HHSearch 92.9660%-122 - C1 -4HO4 ? A:[1-289] MKGIILSGGSGTRLYPLTKVVSKQLLPVYDKPMVYYPLSVLMLAGIKDILIISTPEDTPRFEQLLGGGSELGISLSYAVQSSPDGLAQAFIIGEEFIGDDNVALVLGDNIFYGHGFTELL-QR-AANR-KSGAT-IFGYNVKDPQRFGVVEFDEKGKVISIEEKPEEPKSSYAVTGLYFYDNRVVDIAKNITPSARGELEITDVNKAYLELGELHVELLGRGFAWLDTGTHESLLQASQFIETIEKRQSLKVACLEEIAYRMGYISREQLIKLAEPLMKNEYGQYLMNLAHRS
98 PsiBlast_CBE 92.9262%-120 - C1 -4ARW ? D:[13-297] -KGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDTPRFQQLLGDGSNWGLDLQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHDFHELLGSA-SQ-R-QTGAS-VFAYHVLDPERYGVVEFDQGGKAISLEEKPLEPKSNYAVTGLYFYDQQVVDIARDLKPSPRGELEITDVNRAYLERGQLSVEIMGRGYAWLDTGTHDSLLEAGQFIATLENRQGLKVACPEEIAYRQKWIDAAQLEKLAAPLAKNGYGQYLKRLL---
15 PsiBlast_PDB 92.8059%-125 - C1 -4HO3 ? A:[1-288] MKGIILSGGSGTRLYPLTKVVSKQLLPVYDKPMVYYPLSVLMLAGIKDILIISTPEDTPRFEQLLGGGSELGISLSYAVQSSPDGLAQAFIIGEEFIGDDNVALVLGDNIFYGHGFTELL-QR-AA-NRKSGAT-IFGYNVKDPQRFGVVEFDEKGKVISIEEKPEEPKSSYAVTGLYFYDNRVVDIAKNITPSARGELEITDVNKAYLELGELHVELLGRGFAWLDTGTHESLLQASQFIETIEKRQSLKVACLEEIAYRMGYISREQLIKLAEPLMKNEYGQYLMNLAHR-
88 PsiBlast_CBE 92.7762%-127 - C1 -4B2W ? B:[14-298] -KGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDTPRFQQLLGDGSNWGLDLQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHDFHELLGSA-SQ-R-QTGAS-VFAYHVLDPERYGVVEFDQGGKAISLEEKPLEPKSNYAVTGLYFYDQQVVDIARDLKPS---ELEITDVNRAYLERGQLSVEIMGRGYAWLDTGTHDSLLEAGQFIATLENRQGLKVACPEEIAYRQKWIDAAQLEKLAAPLAKNGYGQYLKRLL---
70 PsiBlast_CBE 92.7662%-121 - C1 -4B4B ? D:[14-298] -KGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDTPRFQQLLGDGSNWGLDLQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHDFHELLGSA-SQ-R-QTGAS-VFAYHVLDPERYGVVEFDQGGKAISLEEKPLEPKSNYAVTGLYFYDQQVVDIARDLKPSPRGELEITDVNRAYLERGQLSVEIMGRGYAWLDTGTHDSLLEAGQFIATLENRQGLKVACPEEIAYRQKWIDAAQLEKLAAPLAKNGYGQYLKRLL---
99 PsiBlast_CBE 92.6662%-127 - C1 -4ARW ? C:[13-297] -KGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDTPRFQQLLGDGSNWGLDLQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHDFHELLGSA-SQ-R-QTGAS-VFAYHVLDPERYGVVEFDQGGKAISLEEKPLEPKSNYAVTGLYFYDQQVVDIARDLKPS--GELEITDVNRAYLERGQLSVEIMGRGYAWLDTGTHDSLLEAGQFIATLENRQGLKVACPEEIAYRQKWIDAAQLEKLAAPLAKNGYGQYLKRLL---
81 PsiBlast_CBE 92.6662%-123 - C1 -4B3U ? A:[14-298] -KGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDTPRFQQLLGDGSNWGLDLQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHDFHELLGSA-SQ-R-QTGAS-VFAYHVLDPERYGVVEFDQGGKAISLEEKPLEPKSNYAVTGLYFYDQQVVDIARDLKPSPRGELEITDVNRAYLERGQLSVEIMGRGYAWLDTGTHDSLLEAGQFIATLENRQGLKVACPEEIAYRQKWIDAAQLEKLAAPLAKNGYGQYLKRLL---
60 PsiBlast_CBE 92.6562%-121 - C1 -4B5B ? B:[14-298] -KGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDTPRFQQLLGDGSNWGLDLQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHDFHELLGSA-SQ-R-QTGAS-VFAYHVLDPERYGVVEFDQGGKAISLEEKPLEPKSNYAVTGLYFYDQQVVDIARDLKPSPRGELEITDVNRAYLERGQLSVEIMGRGYAWLDTGTHDSLLEAGQFIATLENRQGLKVACPEEIAYRQKWIDAAQLEKLAAPLAKNGYGQYLKRLL---
93 PsiBlast_CBE 92.6362%-123 - C1 -3ZLL ? A:[14-298] -KGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDTPRFQQLLGDGSNWGLDLQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHDF