@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Rv0733: (2016-04-25 )
MRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTKLGVEAKRYLDAGDLVPSDLTNELVDDRLNNPDAANGFILDGYPRSVEQAKALHEMLERRGTDIDAVLEFRVSEEVLLERLKGRGRADDTDDVILNRMKVYRDETAPLLEYYRDQLKTVDAVGTMDEVFARALRALGK

Atome Classification :

(87 SA) .........10........20........30........40........50........60........70.-....-..-.80........90........100.......110.......120.....-------------------------------.-------------------------------.-------------------------130-------------------------------..-.......140.......---150...--..-------.--.160.......--170.......180
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTKLGVEAKRYLDAGDLVPSDLTNELVDDRL-NNPD-AA-NGFILDGYPRSVEQAKALHEMLERRGTDIDAVLEFRVSEEVLLERLKGR-------------------------------G-------------------------------R-------------------------A---------------------------------DD-TDDVILNRMKVYRDETA---PLLEYY--RD-------Q--LKTVDAVGTMD--EVFARALRALGK
1 PsiBlast_PDB 97.45100% -99 - C1 -2CDN KAD_MYCTU A:[21-201] MRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTKLGVEAKRYLDAGDLVPSDLTNELVDDRL-NNPD-AA-NGFILDGYPRSVEQAKALHEMLERRGTDIDAVLEFRVSEEVLLERLKGR-------------------------------G-------------------------------R-------------------------A---------------------------------DD-TDDVILNRMKVYRDETA---PLLEYY--RD-------Q--LKTVDAVGTMD--EVFARALRALGK
122 HHSearch 97.41100%-101 - C1 -2CDN KAD_MYCTU A:[21-200] MRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTKLGVEAKRYLDAGDLVPSDLTNELVDDRL-NNPD-AA-NGFILDGYPRSVEQAKALHEMLERRGTDIDAVLEFRVSEEVLLERLKGR-------------------------------G-------------------------------R-------------------------A---------------------------------DD-TDDVILNRMKVYRDETA---PLLEYY--RD-------Q--LKTVDAVGTMD--EVFARALRALG-
114 HHSearch 79.2744% -94 * C1 *4QBG KAD_BACSU B:[1-213] MNIVLMGLPGAGKGTQAERIVAKYGIPHISTGDMFRAAMKEETPLGLEAKSYIDKGELVPDEVTIGIVRERL-SKSD-CE-RGFLLDGFPRTVAQAEALEEILEEMGRKLEHVIHIEVRQEELMERLTGR-------------------------------R-------------------------------I-------------------------CSVCGTTYHLVFNPPKTPGICDKDGGELYQRA--DD-NEETVAKRLEVNMKQMA---PLLAFY--DSKE-----V--LRNVNGQQDME--KVFKDLRELLQ-
2 PsiBlast_PDB 79.13100% -83 - C1 -1P4S - KAD_MYCTU A:[1-181] MRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTKLGVEAKRYLDAGDLVPSDLTNELVDDRL-NNPD-AA-NGFILDGYPRSVEQAKALHEMLERRGTDIDAVLEFRVSEEVLLERLKGR-------------------------------G-------------------------------R-------------------------A---------------------------------DD-TDDVILNRMKVYRDETA---PLLEYY--RD-------Q--LKTVDAVGTMD--EVFARALRALGK
9 PsiBlast_PDB 78.8842% -93 - C1 -4JLD KAD_AQUAE A:[1-203] MILVFLGPPGAGKGTQAKRLAKEKGFVHISTGDILREAVQKGTPLGKKAKEYMERGELVPDDLIIALIEEVF---PK-HG-N-VIFDGFPRTVKQAEALDEMLEKKGLKVDHVLLFEVPDEVVIERLSGRRINPETGEVYHVKYNPPPPGVKVI-------Q-------------------------------R-------------------------E---------------------------------DD-KPEVIKKRLEVYREQTA---PLIEYY--KK-------KGILRIIDASKPVE--EVYRQVLEVIG-
12 PsiBlast_PDB 77.9542% -97 - C1 -3SR0 KAD_AQUAE A:[1-203] MILVFLGPPGAGKGTQAKRLAKEKGFVHISTGDILREAVQKGTPLGKKAKEYMERGELVPDDLIIALIEEVF---PK-HG-N-VIFDGFPRTVKQAEALDEMLEKKGLKVDHVLLFEVPDEVVIERLSGRRINPETGEVYHVKYNPPPPGVKVI-------Q-------------------------------R-------------------------E---------------------------------DD-KPEVIKKRLEVYREQTA---PLIEYY--KK-------KGILRIIDASKPVE--EVYRQVLEVIG-
27 PsiBlast_CBE 77.7842% -95 - C1 -4JKY KAD_AQUAE B:[1-203] MILVFLGPPGAGKGTQAKRLAKEKGFVHISTGDILREAVQKGTPLGKKAKEYMERGELVPDDLIIALIEEVF---PK-HG-N-VIFDGFPRTVKQAEALDEMLEKKGLKVDHVLLFEVPDEVVIERLSGRRINPETGEVYHVKYNPPPPGVKVI-------Q-------------------------------R-------------------------E---------------------------------DD-KPEVIKKRLEVYREQTA---PLIEYY--KK-------KGILRIIDASKPVE--EVYRQVLEVIG-
5 PsiBlast_PDB 77.5342% -94 - C1 -4JL6 KAD_AQUAE A:[1-203] MILVFLGPPGAGKGTQAKRLAKEKGFVHISTGDILREAVQKGTPLGKKAKEYMERGELVPDDLIIALIEEVF---PK-HG-N-VIFDGFPRTVKQAEALDEMLEKKGLKVDHVLLFEVPDEVVIERLSGRRINPETGEVYHVKYNPPPPGVKVI-------Q-------------------------------R-------------------------E---------------------------------DD-KPEVIKKRLEVYREQTA---PLIEYY--KK-------KGILRIIDASKPVE--EVYRQVLEVIG-
116 HHSearch 77.3341%-103 - C1 -1AK2 KAD2_BOVIN A:[17-229] VRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVLELIEKNL-ETPP-CK-NGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGR-------------------------------L-------------------------------I-------------------------HPQSGRSYHEEFNPPKEPMKDDITGEPLIRRS--DD-NKKALKIRLEAYHTQTT---PLVEYY--SKRG-----I--HSAIDASQTPD--VVFASILAAFS-
40 PsiBlast_CBE 77.0935% -87 - C1 -2AKY KAD2_YEAST A:[5-219] IRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQLGLEAKKIMDQGGLVSDDIMVNMIKDELTNNPA-CK-NGFILDGFPRTIPQAEKLDQMLKEQGTPLEKAIELKVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQ-------------------------------R-------------------------S---------------------------------DD-NADALKKRLAAYHAQTE---PIVDFY--KK-------TGIWAGVDASQPPA--TVWADILNKLGK
29 PsiBlast_CBE 76.8942% -92 - C1 -4CF7 KAD_AQUAE B:[1-203] MILVFLGPPGAGKGTQAKRLAKEKGFVHISTGDILREAVQKGTPLGKKAKEYMERGELVPDDLIIALIEEVF---PK-HG-N-VIFDGFPRTVKQAEALDEMLEKKGLKVDHVLLFEVPDEVVIERLSGRRINPETGEVYHVKYNPPPPGVKVI-------Q-------------------------------R-------------------------E---------------------------------DD-KPEVIKKRLEVYREQTA---PLIEYY--KK-------KGILRIIDASKPVE--EVYRQVLEVIG-
15 PsiBlast_PDB 76.6041% -98 - C1 -4JLO KAD_AQUAE A:[1-203] MILVFLGPPGAGKGTQAKRLAKEKGFVHISTGDILREAVQKGTPLGKKAKEYMERGELVPDDLIIALIEEVF---PK-HG-N-VIFDGFPRTVKQAEALDEMLEKKGLKVDHVLLFEVPDEVVIERLSGRRINPETGEVYHVKYNPPPPGVKVI-------Q-------------------------------K-------------------------E---------------------------------DD-KPEVIKKRLEVYREQTA---PLIEYY--KK-------KGILRIIDASKPVE--EVYRQVLEVIG-
19 PsiBlast_PDB 76.5139% -86 - C1 -1ZIN KAD_GEOSE A:[1-213] MNLVLMGLPGAGKGTQAEKIVAAYGIPHISTGDMFRAAMKEGTPLGLQAKQYMDRGDLVPDEVTIGIVRERL-SKDD-CQ-NGFLLDGFPRTVAQAEALETMLADIGRKLDYVIHIDVRQDVLMERLTGRRICRNCGATYHLIFHPPAKPGVCDKCGGELYQ-------------------------------R-------------------------A---------------------------------DD-NEATVANRLEVNMKQMK---PLVDFY--EQ-------KGYLRNINGEQDME--KVFADIRELLG-
31 PsiBlast_CBE 76.5041% -99 - C1 -4JLP KAD_AQUAE B:[1-203] MILVFLGPPGAGKGTQAKRLAKEKGFVHISTGDILREAVQKGTPLGKKAKEYMERGELVPDDLIIALIEEVF---PK-HG-N-VIFDGFPRTVKQAEALDEMLEKKGLKVDHVLLFEVPDEVVIERLSGRRINPETGEVYHVKYNPPPPGVKVI-------Q-------------------------------K-------------------------E---------------------------------DD-KPEVIKKRLEVYREQTA---PLIEYY--KK-------KGILRIIDASKPVE--EVYRQVLEVIG-
38 PsiBlast_CBE 76.1835%-101 - C1 -1AK2 KAD2_BOVIN A:[17-230] VRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVLELIEKNL-ETPP-CK-NGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPQSGRSYHEEFNPPKEPMKDDITGEPLIR-------------------------------R-------------------------S---------------------------------DD-NKKALKIRLEAYHTQTT---PLVEYYSKRG-------I--HSAIDASQTPD--VVFASILAAFSK
4 PsiBlast_PDB 76.0742% -97 - C1 -4JL5 KAD_AQUAE A:[1-203] MILVFLGPPGAGKGTQAKRLAKEKGFVHISTGDILREAVQKGTPLGKKAKEYMERGELVPDDLIIALIEEVF---PK-HG-N-VIFDGFPRTVKQAEALDEMLEKKGLKVDHVLLFEVPDEVVIERLSGRRINPETGEVYHVKYNPPPPGVKVI-------Q-------------------------------R-------------------------E---------------------------------DD-KPEVIKKRLEVYREQTA---PLIEYY--KK-------KGILRIIDASKPVE--EVYRQVLEVIG-
24 PsiBlast_CBE 76.0242% -93 - C1 -4JL8 KAD_AQUAE B:[1-203] MILVFLGPPGAGKGTQAKRLAKEKGFVHISTGDILREAVQKGTPLGKKAKEYMERGELVPDDLIIALIEEVF---PK-HG-N-VIFDGFPRTVKQAEALDEMLEKKGLKVDHVLLFEVPDEVVIERLSGRRINPETGEVYHVKYNPPPPGVKVI-------Q-------------------------------R-------------------------E---------------------------------DD-KPEVIKKRLEVYREQTA---PLIEYY--KK-------KGILRIIDASKPVE--EVYRQVLEVIG-
118 HHSearch 75.9547% -98 - C1 -4JL5 KAD_AQUAE A:[1-202] MILVFLGPPGAGKGTQAKRLAKEKGFVHISTGDILREAVQKGTPLGKKAKEYMERGELVPDDLIIALIEEVF-P----KH-GNVIFDGFPRTVKQAEALDEMLEKKGLKVDHVLLFEVPDEVVIERLSGR-------------------------------R-------------------------------I-------------------------NPETGEVYHVKYNPPPPGVKVIQRE---------DD-KPEVIKKRLEVYREQTA---PLIEYY--KKKG-----I--LRIIDASKPVE--EVYRQVLEVI--
26 PsiBlast_CBE 75.8442% -95 - C1 -4JL5 KAD_AQUAE B:[1-203] MILVFLGPPGAGKGTQAKRLAKEKGFVHISTGDILREAVQKGTPLGKKAKEYMERGELVPDDLIIALIEEVF---PK-HG-N-VIFDGFPRTVKQAEALDEMLEKKGLKVDHVLLFEVPDEVVIERLSGRRINPETGEVYHVKYNPPPPGVKVI-------Q-------------------------------R-------------------------E---------------------------------DD-KPEVIKKRLEVYREQTA---PLIEYY--KK-------KGILRIIDASKPVE--EVYRQVLEVIG-
41 PsiBlast_CBE 75.7635% -85 - C1 -1AKY KAD2_YEAST A:[5-219] IRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQLGLEAKKIMDQGGLVSDDIMVNMIKDELTNNPA-CK-NGFILDGFPRTIPQAEKLDQMLKEQGTPLEKAIELKVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQ-------------------------------R-------------------------S---------------------------------DD-NADALKKRLAAYHAQTE---PIVDFY--KK-------TGIWAGVDASQPPA--TVWADILNKLGK
33 PsiBlast_CBE 75.6740% -86 - C1 -4QBI KAD_GEOSE B:[1-213] MNLVLMGLPGAGKGTQAEKIVEAYGIPHISTGDMFRAAMKEGTPLGLQAKQYMDRGDLVPDEVTIGIVRERL-GKDD-CE-RGFLLDGFPRTVAQAEALEEILEDIGRKIDYVIHIDVRQDVLMERLTGRRICRNCGATYHLIFHPPAKPGVCDKCGGELYQ-------------------------------R-------------------------A---------------------------------DD-NEETVAKRLEVNMKQMK---PLLDFY--EQ-------KGYLRNVNGEQDIE--KVFADVRELLG-
7 PsiBlast_PDB 75.6242% -92 - C1 -4JLA KAD_AQUAE A:[1-203] MILVFLGPPGAGKGTQAKRLAKEKGFVHISTGDILREAVQKGTPLGKKAKEYMERGELVPDDLIIALIEEVF---PK-HG-N-VIFDGFPRTVKQAEALDEMLEKKGLKVDHVLLFEVPDEVVIERLSGRRINPETGEVYHVKYNPPPPGVKVI-------Q-------------------------------R-------------------------E---------------------------------DD-KPEVIKKRLEVYREQTA---PLIEYY--KK-------KGILRIIDASKPVE--EVYRQVLEVIG-
16 PsiBlast_PDB 75.5441% -95 - C1 -4JLP KAD_AQUAE A:[1-203] MILVFLGPPGAGKGTQAKRLAKEKGFVHISTGDILREAVQKGTPLGKKAKEYMERGELVPDDLIIALIEEVF---PK-HG-N-VIFDGFPRTVKQAEALDEMLEKKGLKVDHVLLFEVPDEVVIERLSGRRINPETGEVYHVKYNPPPPGVKVI-------Q-------------------------------K-------------------------E---------------------------------DD-KPEVIKKRLEVYREQTA---PLIEYY--KK-------KGILRIIDASKPVE--EVYRQVLEVIG-
25 PsiBlast_CBE 75.4342% -95 - C1 -4JL6 KAD_AQUAE B:[1-203] MILVFLGPPGAGKGTQAKRLAKEKGFVHISTGDILREAVQKGTPLGKKAKEYMERGELVPDDLIIALIEEVF---PK-HG-N-VIFDGFPRTVKQAEALDEMLEKKGLKVDHVLLFEVPDEVVIERLSGRRINPETGEVYHVKYNPPPPGVKVI-------Q-------------------------------R-------------------------E---------------------------------DD-KPEVIKKRLEVYREQTA---PLIEYY--KK-------KGILRIIDASKPVE--EVYRQVLEVIG-
8 PsiBlast_PDB 75.3342% -93 - C1 -4JLB KAD_AQUAE A:[1-203] MILVFLGPPGAGKGTQAKRLAKEKGFVHISTGDILREAVQKGTPLGKKAKEYMERGELVPDDLIIALIEEVF---PK-HG-N-VIFDGFPRTVKQAEALDEMLEKKGLKVDHVLLFEVPDEVVIERLSGRRINPETGEVYHVKYNPPPPGVKVI-------Q-------------------------------R-------------------------E---------------------------------DD-KPEVIKKRLEVYREQTA---PLIEYY--KK-------KGILRIIDASKPVE--EVYRQVLEVIG-
32 PsiBlast_CBE 75.1841% -98 - C1 -4JLO KAD_AQUAE B:[1-203] MILVFLGPPGAGKGTQAKRLAKEKGFVHISTGDILREAVQKGTPLGKKAKEYMERGELVPDDLIIALIEEVF---PK-HG-N-VIFDGFPRTVKQAEALDEMLEKKGLKVDHVLLFEVPDEVVIERLSGRRINPETGEVYHVKYNPPPPGVKVI-------Q-------------------------------K-------------------------E---------------------------------DD-KPEVIKKRLEVYREQTA---PLIEYY--KK-------KGILRIIDASKPVE--EVYRQVLEVIG-
23 PsiBlast_CBE 75.0642% -91 - C1 -4JLA KAD_AQUAE B:[1-203] MILVFLGPPGAGKGTQAKRLAKEKGFVHISTGDILREAVQKGTPLGKKAKEYMERGELVPDDLIIALIEEVF---PK-HG-N-VIFDGFPRTVKQAEALDEMLEKKGLKVDHVLLFEVPDEVVIERLSGRRINPETGEVYHVKYNPPPPGVKVI-------Q-------------------------------R-------------------------E---------------------------------DD-KPEVIKKRLEVYREQTA---PLIEYY--KK-------KGILRIIDASKPVE--EVYRQVLEVIG-
28 PsiBlast_CBE 74.8642% -95 - C1 -4IKE KAD_AQUAE B:[1-203] MILVFLGPPGAGKGTQAKRLAKEKGFVHISTGDILREAVQKGTPLGKKAKEYMERGELVPDDLIIALIEEVF---PK-HG-N-VIFDGFPRTVKQAEALDEMLEKKGLKVDHVLLFEVPDEVVIERLSGRRINPETGEVYHVKYNPPPPGVKVI-------Q-------------------------------R-------------------------E---------------------------------DD-KPEVIKKRLEVYREQTA---PLIEYY--KK-------KGILRIIDASKPVE--EVYRQVLEVIG-
22 PsiBlast_CBE 74.7942% -94 - C1 -4JLB KAD_AQUAE B:[1-203] MILVFLGPPGAGKGTQAKRLAKEKGFVHISTGDILREAVQKGTPLGKKAKEYMERGELVPDDLIIALIEEVF---PK-HG-N-VIFDGFPRTVKQAEALDEMLEKKGLKVDHVLLFEVPDEVVIERLSGRRINPETGEVYHVKYNPPPPGVKVI-------Q-------------------------------R-------------------------E---------------------------------DD-KPEVIKKRLEVYREQTA---PLIEYY--KK-------KGILRIIDASKPVE--EVYRQVLEVIG-
14 PsiBlast_PDB 74.7642% -92 - C1 -4CF7 KAD_AQUAE A:[1-203] MILVFLGPPGAGKGTQAKRLAKEKGFVHISTGDILREAVQKGTPLGKKAKEYMERGELVPDDLIIALIEEVF---PK-HG-N-VIFDGFPRTVKQAEALDEMLEKKGLKVDHVLLFEVPDEVVIERLSGRRINPETGEVYHVKYNPPPPGVKVI-------Q-------------------------------R-------------------------E---------------------------------DD-KPEVIKKRLEVYREQTA---PLIEYY--KK-------KGILRIIDASKPVE--EVYRQVLEVIG-
13 PsiBlast_PDB 74.7342% -93 - C1 -4IKE KAD_AQUAE A:[1-203] MILVFLGPPGAGKGTQAKRLAKEKGFVHISTGDILREAVQKGTPLGKKAKEYMERGELVPDDLIIALIEEVF---PK-HG-N-VIFDGFPRTVKQAEALDEMLEKKGLKVDHVLLFEVPDEVVIERLSGRRINPETGEVYHVKYNPPPPGVKVI-------Q-------------------------------R-------------------------E---------------------------------DD-KPEVIKKRLEVYREQTA---PLIEYY--KK-------KGILRIIDASKPVE--EVYRQVLEVIG-
115 HHSearch 74.4041% -91 - C1 -1AKY KAD2_YEAST A:[5-218] IRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQLGLEAKKIMDQGGLVSDDIMVNMIKDEL-TNNPACK-NGFILDGFPRTIPQAEKLDQMLKEQGTPLEKAIELKVDDELLVARITGR-------------------------------L-------------------------------I-------------------------HPASGRSYHKIFNPPKEDMKDDVTGEALVQRS--DD-NADALKKRLAAYHAQTE---PIVDFY--KKTG-----I--WAGVDASQPPA--TVWADILNKLG-
20 PsiBlast_PDB 74.2039% -87 - C1 -1ZIO KAD_GEOSE A:[1-213] MNLVLMGLPGAGKGTQAEKIVAAYGIPHISTGDMFRAAMKEGTPLGLQAKQYMDRGDLVPDEVTIGIVRERL-SKDD-CQ-NGFLLDGFPRTVAQAEALETMLADIGRKLDYVIHIDVRQDVLMERLTGRRICRNCGATYHLIFHPPAKPGVCDKCGGELYQ-------------------------------R-------------------------A---------------------------------DD-NEATVANRLEVNMKQMK---PLVDFY--EQ-------KGYLRNINGEQDME--KVFADIRELLG-
30 PsiBlast_CBE 74.0942% -94 - C1 -3SR0 KAD_AQUAE B:[1-203] MILVFLGPPGAGKGTQAKRLAKEKGFVHISTGDILREAVQKGTPLGKKAKEYMERGELVPDDLIIALIEEVF---PK-HG-N-VIFDGFPRTVKQAEALDEMLEKKGLKVDHVLLFEVPDEVVIERLSGRRINPETGEVYHVKYNPPPPGVKVI-------Q-------------------------------R-------------------------E---------------------------------DD-KPEVIKKRLEVYREQTA---PLIEYY--KK-------KGILRIIDASKPVE--EVYRQVLEVIG-
51 PsiBlast_CBE 74.0639% -89 - C1 -4QBG KAD_BACSU B:[1-205] MNIVLMGLPGAGKGTQAERIVAKYGIPHISTGDMFRAAMKEETPLGLEAKSYIDKGELVPDEVTIGIVRERL-SKSD-CE-RGFLLDGFPRTVAQAEALEEILEEMGRKLEHVIHIEVRQEELMERLTGRRICSVCGTTYHLVFNPPKTPGICDKDGGELYQ-------------------------------R-------------------------A---------------------------------DD-NEETVAKRLEVNMKQMA---PLLAFYDSKE-------V--LRNVNGQQDME--KVF---------
6 PsiBlast_PDB 73.8642% -88 - C1 -4JL8 KAD_AQUAE A:[1-203] MILVFLGPPGAGKGTQAKRLAKEKGFVHISTGDILREAVQKGTPLGKKAKEYMERGELVPDDLIIALIEEVF---PK-HG-N-VIFDGFPRTVKQAEALDEMLEKKGLKVDHVLLFEVPDEVVIERLSGRRINPETGEVYHVKYNPPPPGVKVI-------Q-------------------------------R-------------------------E---------------------------------DD-KPEVIKKRLEVYREQTA---PLIEYY--KK-------KGILRIIDASKPVE--EVYRQVLEVIG-
34 PsiBlast_CBE 73.6439% -85 - C1 -1ZIP KAD_GEOSE A:[1-213] MNLVLMGLPGAGKGTQAEKIVAAYGIPHISTGDMFRAAMKEGTPLGLQAKQYMDRGDLVPDEVTIGIVRERL-SKDD-CQ-NGFLLDGFPRTVAQAEALETMLADIGRKLDYVIHIDVRQDVLMERLTGRRICRNCGATYHLIFHPPAKPGVCDKCGGELYQ-------------------------------R-------------------------A---------------------------------DD-NEATVANRLEVNMKQMK---PLVDFY--EQ-------KGYLRNINGEQDME--KVFADIRELLG-
45 PsiBlast_CBE 73.5041% -83 - C1 -4MKG KAD_BACSU A:[1-213] MNIVLMGLPGAGKGTQAERIVEKYGIPHISTGDMFRAAMKEETPLGLEAKSYIDKGELVPDEVTIGIVRERL-SKSD-CE-RGFLLDGFPRTVAQAEALEEILEEMGRPIDYVINIQVDKEELMERLTGRRICSVCGTTYHLVFNPPKTPGICDKDGGELYQ-------------------------------R-------------------------A---------------------------------DD-NEETVTKRLEVNMKQTA---PLLAFY--DS-------K--EVLVNVNGQQDIQDVFADVKVILG-
17 PsiBlast_PDB 73.3140% -90 - C1 -4QBI KAD_GEOSE A:[1-213] MNLVLMGLPGAGKGTQAEKIVEAYGIPHISTGDMFRAAMKEGTPLGLQAKQYMDRGDLVPDEVTIGIVRERL-GKDD-CE-RGFLLDGFPRTVAQAEALEEILEDIGRKIDYVIHIDVRQDVLMERLTGRRICRNCGATYHLIFHPPAKPGVCDKCGGELYQ-------------------------------R-------------------------A---------------------------------DD-NEETVAKRLEVNMKQMK---PLLDFY--EQ-------KGYLRNVNGEQDIE--KVFADVRELLG-
71 PsiBlast_CBE 73.1939% -94 - C1 -4TYP KAD_BACSU A:[1-205] MNIVLMGLPGAGKGTQAEKIVAKYGIPHISTGDMFRAAMKEETPLGLEAKSYIDKGELVPDEVTIGIVRERL-S-------RGFLLDGFPRTVAQAEALEEILEEMGRKLEHVIHIDVRQEELMERLTGRRICSVCGTTYHLVFNPPKTPGICDKDGGELYQ-------------------------------R-------------------------A---------------------------------DD-NEETVAKRLEVNMKQMK---PLLAFYDSKE-------V--LRNVNGEQDME--KVF---------
44 PsiBlast_CBE 73.1840% -84 - C1 -4QBH KAD_GEOSE A:[1-213] MNLVLMGLPGAGKGTQAERIVEAYGIPHISTGDMFRAAMKEGTPLGLQAKQYMDRGDLVPDEVTIGIVRERL-GKDD-CE-RGFLLDGFPRTVAQAEALEEILEEIGRPIDYVIHIEVRQDVLMERLTGRRICRNCGATYHLIFHPPAKPGVCDKCGGELYQ-------------------------------R-------------------------A---------------------------------DD-NEETVAKRLEVNMKQMK---PLLDFY--EQ-------KGYLRNVNGQQDMQ--DVFADVRELLG-
46 PsiBlast_CBE 73.0141% -86 - C1 -3DKV KAD_BACSU A:[1-213] MNIVLMGLPGAGKGTQAERIVEKYGIPHISTGDMFRAAMKEETPLGLEAKSYIDKGELVPDEVTIGIVRERL-SKSD-CE-RGFLLDGFPRTVAQAEALEEILEEMGRPIDYVINIQVDKEELMERLTGRRICSVCGTTYHLVFNPPKTPGICDKDGGELYQ-------------------------------R-------------------------A---------------------------------DD-NEETVTKRLEVNMKQTA---PLLAFY--DS-------K--EVLVNVNGQQDIQDVFADVKVILG-
42 PsiBlast_CBE 72.9635% -84 - C1 -3AKY KAD2_YEAST A:[5-219] IRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQLGLEAKKIMDQGGLVSDDIMVNMIKDELTNNPA-CK-NGFILDGFPRTIPQAEKLDQMLKEQGTPLEKAIELKVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQ-------------------------------R-------------------------S---------------------------------DD-NADALKKRLAAYHAQTE---PIVDFY--KK-------TGIWAGVDASQPPA--TVWADFLNKLGK
47 PsiBlast_CBE 72.9135% -88 - C1 -1DVR KAD2_YEAST B:[5-219] IRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQLGLEAKKIMDQGGLVSDDIMVNMIKDELTNNPA-CK-NGFILVGFPRTIPQAEKLDQMLKEQGTPLEKAIELKVDDELLVARITGRLIHPAS-------------------------G-------------------------------RSYHKIFNPPKEDMKDDVTGEALVQIS---------------------------------DD-NADALKKRLAAYHAQTE---PIVDFY--KK-------TGIWAGVDASQPPA--TVWADILNKLGK
99 PsiBlast_CBE 72.7435% -77 - C1 -4NU0 KAD_STRP2 B:[6-213] MNLLIMGLPGAGKGTQAAKIVEQFHVAHISTGDMFRAAMANQTEMGVLAKSYIDKGELVPDEVTNGIVKERL-SQDD-IKETGFLLDGYPRTIEQAHALDKTLAELGIELEGIINIEVNPDSLLERLSGRIIHRVTGETFHKVFNPPVDYKEEDYY-----Q-------------------------------R-------------------------E---------------------------------DD-KPETVKRRLDVNIAQGE---PIIAHY--RA-------K--GLVHDIEGNQDINDVFSDIEKVL--
3 PsiBlast_PDB 72.2942% -96 - C1 -4JKY KAD_AQUAE A:[1-203] MILVFLGPPGAGKGTQAKRLAKEKGFVHISTGDILREAVQKGTPLGKKAKEYMERGELVPDDLIIALIEEVF---PK-HG-N-VIFDGFPRTVKQAEALDEMLEKKGLKVDHVLLFEVPDEVVIERLSGRRINPETGEVYHVKYNPPPPGVKVI-------Q-------------------------------R-------------------------E---------------------------------DD-KPEVIKKRLEVYREQTA---PLIEYY--KK-------KGILRIIDASKPVE--EVYRQVLEVIG-
10 PsiBlast_PDB 71.9542% -89 - C1 -2RGX KAD_AQUAE A:[1-203] MILVFLGPPGAGKGTQAKRLAKEKGFVHISTGDILREAVQKGTPLGKKAKEYMERGELVPDDLIIALIEEVF---PK-HG-N-VIFDGFPRTVKQAEALDEMLEKKGLKVDHVLLFEVPDEVVIERLSGRRINPETGEVYHVKYNPPPPGVKVI-------Q-------------------------------R-------------------------E---------------------------------DD-KPEVIKKRLEVYREQTA---PLIEYY--KK-------KGILRIIDASKPVE--EVYRQVLEVIG-
67 PsiBlast_CBE 71.5539% -87 - C1 -4TYQ KAD_BACSU A:[1-205] MNIVLMGLPGAGKGTQAERIVAKYGIPHISTGDMFRAAMKEETPLGLEAKSYIDKGELVPDEVTIGIVRERL-SKSD-CE-RGFLLDGFPRTVAQAEALEEILEEMGRKLEYVIHIEVRQEELMERLTGRRICSVCGTTYHLVFNPPKTPGICDKDGGELYQ-------------------------------R-------------------------A---------------------------------DD-NEETVAKRLEVNMKQMA---PLLAFYDSKE-------V--LVNVNGQQDME--KVF---------
43 PsiBlast_CBE 71.5240% -88 - C1 -4QBH KAD_GEOSE B:[1-213] MNLVLMGLPGAGKGTQAERIVEAYGIPHISTGDMFRAAMKEGTPLGLQAKQYMDRGDLVPDEVTIGIVRERL-GKDD-CE-RGFLLDGFPRTVAQAEALEEILEEIGRPIDYVIHIEVRQDVLMERLTGRRICRNCGATYHLIFHPPAKPGVCDKCGGELYQ-------------------------------R-------------------------A---------------------------------DD-NEETVAKRLEVNMKQMK---PLLDFY--EQ-------KGYLRNVNGQQDMQ--DVFADVRELLG-
39 PsiBlast_CBE 71.3838% -87 - C1 -3FB4 ? A:[1-206] MNIVLMGLPGAGKGTQAEQIIEKYEIPHISTGDMFRAAIKNGTELGLKAKSFMDQGNLVPDEVTIGIVHERL-SKDD-CQ-KGFLLDGFPRTVAQADALDSLLTDLGKKLDYVLNIKVEQEELMKRLTGR-------------------------------WICKTCGATYHTIFNPPAVEGICDKDGGELYQR-------------------------I---------------------------------DD-KPETVKNRLDVNMKQTQ---PLLDFY--SQ-------KGVLKDIDGQQDIK--KVFV--------
52