@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Rv1187: (2016-04-29 )
MDAITQVPVPANEPVHDYAPKSPERTRLRTELASLADHPIDLPHVIGGRHRMGDGERIDVVQPHRHAARLGTLTNATHADAAAAVEAAMSAKSDWAALPFDERAAVFLRAADLLAGPWREKIAAATMLGQSKSVYQAEIDAVCELIDFWRFNVAFARQILEQQPISGPGEWNRIDYRPLDGFVYAITPFNFTSIAGNLPTAPALMGNTVIWKPSITQTLAAYLTMQLLEAAGLPPGVINLVTGDGFAVSDVALADPRLAGIHFTGSTATFGHLWQWVGTNIGRYHSYPRLVGETGGKDFVVAHASARPDVLRTALIRGAFDYQGQKCSAVSRAFIAHSVWQRMGDELLAKAAELRYGDITDLSNYGGALIDQRAFVKNVDAIERAKGAAAVTVAVGGEYDDSEGYFVRPTVLLSDDPTDESFVIEYFGPLLSVHVYPDERYEQILDVIDTGSRYALTGAVIADDRQAVLTALDRLRFAAGNFYVNDKPTGAVVGRQPFGGARGSGTNDKAGSPLNLLRWTSARSIKETFVAATDHIYPHMAVD

Atome Classification :

(62 SA) .........10........20......---..30........40........50........60.--.......70........80........90........100.......110....-...120.......130.......-140.......150.......160-----...-....170.......180.......190........200.......210.......220.......230.......240.......250.......260.......270.......280-........290.......300.......310.......320.......330.......340.......-----350......-.360........370.......380.......390.......400.......410.......420.......430.......440.......450.......460.......470.......480.......490.......500.......510.......520.......530.......540.
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MDAITQVPVPANEPVHDYAPKSPERTR---LRTELASLADHPIDLPHVIGGRHRMGDGERIDVVQ--PHRHAARLGTLTNATHADAAAAVEAAMSAKSDWAALPFDERAAVFLRAADLLAG-PWREKIAAATMLGQSKSVYQAEI-DAVCELIDFWRFNVAFARQILEQ-----QPI-SGPGEWNRIDYRPLDGFVYAITPFNF-TSIAGNLPTAPALMGNTVIWKPSITQTLAAYLTMQLLEAAGLPPGVINLVTGDGFAVSDVALADPRLAGIHFTGSTATFGHLWQWVGTNI--GRYHSYPRLVGETGGKDFVVAHASARPDVLRTALIRGAFDYQGQKCSAVSRAFIAHSVWQRMGDELLA-----KAAELRYGD-IT-DLSNYGGALIDQRAFVKNVDAIERAKGAAAVTVAVGGEYDDSEGYFVRPTVLLSDDPTDESFVIEYFGPLLSVHVYPDERYEQILDVIDTGSRYALTGAVIADDRQAVLTALDRLRFAAGNFYVNDKPTGAVVGRQPFGGARGSGTNDKAGSPLNLLRWTSARSIKETFVAATDHIYPHMAVD
25 PsiBlast_CBE 98.6399% -97 - C3 -4LEM ? F:[21-561] MDAITQVPVPANEPVHDYAPKSPERTR---LRTELASLADHPIDLPHVIGGRHRMGDGERIDVVQ--PHRHAARLGTLTNATHADAAAAVEAAMSAKSDWAALPFDERAAVFLRAADLLAG-PWREKIAAATMLGQSKSVYQAEI-DAVCELIDFWRFNVAFARQILEQ-----QPI-SGPGEWNRIDYRPLDGFVYAITPFNF-TSIAGNLPTAPALMGNTVIWKPSITQTLAAYLTMQLLEAAGLPPGVINLVTGDGFAVSDVALADPRLAGIHFTGSTATFGHLWQWVGTNI--GRYHSYPRLVGETGGKDFVVAHASARPDVLRTALIRGAFDYQGQKCSAVSRAFIAHSVWQRMGDELLA-----KAAELRYGD-IT-DLSNYGGALIDQRAFVKNVDAIERAKGAAAVTVAVGGEYDDSEGYFVRPTVLLSDDP---SFVIEYFGPLLSVHVYPDERYEQILDVIDTGSRYALTGAVIADDRQAVLTALDRLRFAAGNFYVNDKPTGAVVGRQPFGGARGSDTNDKAGSPLNLLRWTSARSIKETFVAATDHIYPHMA--
28 PsiBlast_CBE 98.5999% -97 - C3 -4LEM ? B:[21-562] MDAITQVPVPANEPVHDYAPKSPERTR---LRTELASLADHPIDLPHVIGGRHRMGDGERIDVVQ--PHRHAARLGTLTNATHADAAAAVEAAMSAKSDWAALPFDERAAVFLRAADLLAG-PWREKIAAATMLGQSKSVYQAEI-DAVCELIDFWRFNVAFARQILEQ-----QPI-SGPGEWNRIDYRPLDGFVYAITPFNF-TSIAGNLPTAPALMGNTVIWKPSITQTLAAYLTMQLLEAAGLPPGVINLVTGDGFAVSDVALADPRLAGIHFTGSTATFGHLWQWVGTNI--GRYHSYPRLVGETGGKDFVVAHASARPDVLRTALIRGAFDYQGQKCSAVSRAFIAHSVWQRMGDELLA-----KAAELRYGD-IT-DLSNYGGALIDQRAFVKNVDAIERAKGAAAVTVAVGGEYDDSEGYFVRPTVLLSDDPTDESFVIEYFGPLLSVHVYPDERYEQILDVIDTGSRYALTGAVIADDRQAVLTALDRLRFAAGNFYVNDKPTGAVVGRQPFGGARGSDTNDKAGSPLNLLRWTSARSIKETFVAATDHIYPHMAV-
26 PsiBlast_CBE 98.3399% -96 - C3 -4LEM ? D:[21-563] MDAITQVPVPANEPVHDYAPKSPERTR---LRTELASLADHPIDLPHVIGGRHRMGDGERIDVVQ--PHRHAARLGTLTNATHADAAAAVEAAMSAKSDWAALPFDERAAVFLRAADLLAG-PWREKIAAATMLGQSKSVYQAEI-DAVCELIDFWRFNVAFARQILEQ-----QPI-SGPGEWNRIDYRPLDGFVYAITPFNF-TSIAGNLPTAPALMGNTVIWKPSITQTLAAYLTMQLLEAAGLPPGVINLVTGDGFAVSDVALADPRLAGIHFTGSTATFGHLWQWVGTNI--GRYHSYPRLVGETGGKDFVVAHASARPDVLRTALIRGAFDYQGQKCSAVSRAFIAHSVWQRMGDELLA-----KAAELRYGD-IT-DLSNYGGALIDQRAFVKNVDAIERAKGAAAVTVAVGGEYDDSEGYFVRPTVLLSDDPTDESFVIEYFGPLLSVHVYPDERYEQILDVIDTGSRYALTGAVIADDRQAVLTALDRLRFAAGNFYVNDKPTGAVVGRQPFGGARGSDTNDKAGSPLNLLRWTSARSIKETFVAATDHIYPHMAVD
1 PsiBlast_PDB 98.3199% -97 - C3 -4IHI ? A:[21-562] MDAITQVPVPANEPVHDYAPKSPERTR---LRTELASLADHPIDLPHVIGGRHRMGDGERIDVVQ--PHRHAARLGTLTNATHADAAAAVEAAMSAKSDWAALPFDERAAVFLRAADLLAG-PWREKIAAATMLGQSKSVYQAEI-DAVCELIDFWRFNVAFARQILEQ-----QPI-SGPGEWNRIDYRPLDGFVYAITPFNF-TSIAGNLPTAPALMGNTVIWKPSITQTLAAYLTMQLLEAAGLPPGVINLVTGDGFAVSDVALADPRLAGIHFTGSTATFGHLWQWVGTNI--GRYHSYPRLVGETGGKDFVVAHASARPDVLRTALIRGAFDYQGQKCSAVSRAFIAHSVWQRMGDELLA-----KAAELRYGD-IT-DLSNYGGALIDQRAFVKNVDAIERAKGAAAVTVAVGGEYDDSEGYFVRPTVLLSDDP-------EYFGPLLSVHVYPDERYEQILDVIDTGSRYALTGAVIADDRQAVLTALDRLRFAAGNFYVNDKPTGAVVGRQPFGGARGSDTNDKAGSPLNLLRWTSARSIKETFVAATDHIYPHMAV-
24 PsiBlast_CBE 98.2899% -96 - C3 -4NS3 ? C:[21-563] MDAITQVPVPANEPVHDYAPKSPERTR---LRTELASLADHPIDLPHVIGGRHRMGDGERIDVVQ--PHRHAARLGTLTNATHADAAAAVEAAMSAKSDWAALPFDERAAVFLRAADLLAG-PWREKIAAATMLGQSKSVYQAEI-DAVCELIDFWRFNVAFARQILEQ-----QPI-SGPGEWNRIDYRPLDGFVYAITPFNF-TSIAGNLPTAPALMGNTVIWKPSITQTLAAYLTMQLLEAAGLPPGVINLVTGDGFAVSDVALADPRLAGIHFTGSTATFGHLWQWVGTNI--GRYHSYPRLVGETGGKDFVVAHASARPDVLRTALIRGAFDYQGQKCSAVSRAFIAHSVWQRMGDELLA-----KAAELRYGD-IT-DLSNYGGALIDQRAFVKNVDAIERAKGAAAVTVAVGGEYDDSEGYFVRPTVLLSDDPTDESFVIEYFGPLLSVHVYPDERYEQILDVIDTGSRYALTGAVIADDRQAVLTALDRLRFAAGNFYVNDKPTGAVVGRQPFGGARGSDTNDKAGSPLNLLRWTSARSIKETFVAATDHIYPHMAVD
22 PsiBlast_CBE 98.1399% -99 - C3 -4NS3 ? E:[21-562] MDAITQVPVPANEPVHDYAPKSPERTR---LRTELASLADHPIDLPHVIGGRHRMGDGERIDVVQ--PHRHAARLGTLTNATHADAAAAVEAAMSAKSDWAALPFDERAAVFLRAADLLAG-PWREKIAAATMLGQSKSVYQAEI-DAVCELIDFWRFNVAFARQILEQ-----QPI-SGPGEWNRIDYRPLDGFVYAITPFNF-TSIAGNLPTAPALMGNTVIWKPSITQTLAAYLTMQLLEAAGLPPGVINLVTGDGFAVSDVALADPRLAGIHFTGSTATFGHLWQWVGTNI--GRYHSYPRLVGETGGKDFVVAHASARPDVLRTALIRGAFDYQGQKCSAVSRAFIAHSVWQRMGDELLA-----KAAELRYGD-IT-DLSNYGGALIDQRAFVKNVDAIERAKGAAAVTVAVGGEYDDSEGYFVRPTVLLSDDP--------YFGPLLSVHVYPDERYEQILDVIDTG--YALTGAVIADDRQAVLTALDRLRFAAGNFYVNDKPT-AVVGRQPFGGARGSDTNDKAGSPLNLLRWTSARSIKETFVAATDHIYPHMAV-
5 PsiBlast_PDB 98.0399% -96 - C3 -4NS3 ? A:[21-561] MDAITQVPVPANEPVHDYAPKSPERTR---LRTELASLADHPIDLPHVIGGRHRMGDGERIDVVQ--PHRHAARLGTLTNATHADAAAAVEAAMSAKSDWAALPFDERAAVFLRAADLLAG-PWREKIAAATMLGQSKSVYQAEI-DAVCELIDFWRFNVAFARQILEQ-----QPI-SGPGEWNRIDYRPLDGFVYAITPFNF-TSIAGNLPTAPALMGNTVIWKPSITQTLAAYLTMQLLEAAGLPPGVINLVTGDGFAVSDVALADPRLAGIHFTGSTATFGHLWQWVGTNI--GRYHSYPRLVGETGGKDFVVAHASARPDVLRTALIRGAFDYQGQKCSAVSRAFIAHSVWQRMGDELLA-----KAAELRYGD-IT-DLSNYGGALIDQRAFVKNVDAIERAKGAAAVTVAVGGEYDDSEGYFVRPTVLLSDDPTDESFVIEYFGPLLSVHVYPDERYEQILDVIDTGSRYALTGAVIADDRQAVLTALDRLRFAAGNFYVNDKPTGAVVGRQPFGGARGSDTNDKAGSPLNLLRWTSARSIKETFVAATDHIYPHMA--
4 PsiBlast_PDB 97.9199% -95 - C3 -4LEM ? A:[21-561] MDAITQVPVPANEPVHDYAPKSPERTR---LRTELASLADHPIDLPHVIGGRHRMGDGERIDVVQ--PHRHAARLGTLTNATHADAAAAVEAAMSAKSDWAALPFDERAAVFLRAADLLAG-PWREKIAAATMLGQSKSVYQAEI-DAVCELIDFWRFNVAFARQILEQ-----QPI-SGPGEWNRIDYRPLDGFVYAITPFNF-TSIAGNLPTAPALMGNTVIWKPSITQTLAAYLTMQLLEAAGLPPGVINLVTGDGFAVSDVALADPRLAGIHFTGSTATFGHLWQWVGTNI--GRYHSYPRLVGETGGKDFVVAHASARPDVLRTALIRGAFDYQGQKCSAVSRAFIAHSVWQRMGDELLA-----KAAELRYGD-IT-DLSNYGGALIDQRAFVKNVDAIERAKGAAAVTVAVGGEYDDSEGYFVRPTVLLSDDPTDESFVIEYFGPLLSVHVYPDERYEQILDVIDTGSRYALTGAVIADDRQAVLTALDRLRFAAGNFYVNDKPTGAVVGRQPFGGARGSDTNDKAGSPLNLLRWTSARSIKETFVAATDHIYPHMA--
27 PsiBlast_CBE 97.8599% -95 - C3 -4LEM ? C:[21-563] MDAITQVPVPANEPVHDYAPKSPERTR---LRTELASLADHPIDLPHVIGGRHRMGDGERIDVVQ--PHRHAARLGTLTNATHADAAAAVEAAMSAKSDWAALPFDERAAVFLRAADLLAG-PWREKIAAATMLGQSKSVYQAEI-DAVCELIDFWRFNVAFARQILEQ-----QPI-SGPGEWNRIDYRPLDGFVYAITPFNF-TSIAGNLPTAPALMGNTVIWKPSITQTLAAYLTMQLLEAAGLPPGVINLVTGDGFAVSDVALADPRLAGIHFTGSTATFGHLWQWVGTNI--GRYHSYPRLVGETGGKDFVVAHASARPDVLRTALIRGAFDYQGQKCSAVSRAFIAHSVWQRMGDELLA-----KAAELRYGD-IT-DLSNYGGALIDQRAFVKNVDAIERAKGAAAVTVAVGGEYDDSEGYFVRPTVLLSDDPTDESFVIEYFGPLLSVHVYPDERYEQILDVIDTGSRYALTGAVIADDRQAVLTALDRLRFAAGNFYVNDKPTGAVVGRQPFGGARGSDTNDKAGSPLNLLRWTSARSIKETFVAATDHIYPHMAVD
3 PsiBlast_PDB 97.5899% -95 - C3 -4JDC ? A:[21-563] MDAITQVPVPANEPVHDYAPKSPERTR---LRTELASLADHPIDLPHVIGGRHRMGDGERIDVVQ--PHRHAARLGTLTNATHADAAAAVEAAMSAKSDWAALPFDERAAVFLRAADLLAG-PWREKIAAATMLGQSKSVYQAEI-DAVCELIDFWRFNVAFARQILEQ-----QPI-SGPGEWNRIDYRPLDGFVYAITPFNF-TSIAGNLPTAPALMGNTVIWKPSITQTLAAYLTMQLLEAAGLPPGVINLVTGDGFAVSDVALADPRLAGIHFTGSTATFGHLWQWVGTNI--GRYHSYPRLVGETGGKDFVVAHASARPDVLRTALIRGAFDYQGQKCSAVSRAFIAHSVWQRMGDELLA-----KAAELRYGD-IT-DLSNYGGALIDQRAFVKNVDAIERAKGAAAVTVAVGGEYDDSEGYFVRPTVLLSDDPT-------YFGPLLSVHVYPDERYEQILDVIDTGSRYALTGAVIADDRQAVLTALDRLRFAAGNFYVNDKPTGAVVGRQPFGGARGSDTNDKAGSPLNLLRWTSARSIKETFVAATDHIYPHMAVD
21 PsiBlast_CBE 97.5099% -96 - C3 -4NS3 ? F:[21-561] MDAITQVPVPANEPVHDYAPKSPERTR---LRTELASLADHPIDLPHVIGGRHRMGDGERIDVVQ--PHRHAARLGTLTNATHADAAAAVEAAMSAKSDWAALPFDERAAVFLRAADLLAG-PWREKIAAATMLGQSKSVYQAEI-DAVCELIDFWRFNVAFARQILEQ-----QPI-SGPGEWNRIDYRPLDGFVYAITPFNF-TSIAGNLPTAPALMGNTVIWKPSITQTLAAYLTMQLLEAAGLPPGVINLVTGDGFAVSDVALADPRLAGIHFTGSTATFGHLWQWVGTNI--GRYHSYPRLVGETGGKDFVVAHASARPDVLRTALIRGAFDYQGQKCSAVSRAFIAHSVWQRMGDELLA-----KAAELRYGD-IT-DLSNYGGALIDQRAFVKNVDAIERAKGAAAVTVAVGGEYDDSEGYFVRPTVLLSDDP-------EYFGPLLSVHVYPDERYEQILDVIDTGSRYALTGAVIADDRQAVLTALDRLRFAAGNFYVNDKPTGAVVGRQPFGGARGSDTNDKAGSPLNLLRWTSARSIKETFVAATDHIYPHMA--
23 PsiBlast_CBE 97.2599% -95 - C3 -4NS3 ? D:[21-563] MDAITQVPVPANEPVHDYAPKSPERTR---LRTELASLADHPIDLPHVIGGRHRMGDGERIDVVQ--PHRHAARLGTLTNATHADAAAAVEAAMSAKSDWAALPFDERAAVFLRAADLLAG-PWREKIAAATMLGQSKSVYQAEI-DAVCELIDFWRFNVAFARQILEQ-----QPI-SGPGEWNRIDYRPLDGFVYAITPFNF-TSIAGNLPTAPALMGNTVIWKPSITQTLAAYLTMQLLEAAGLPPGVINLVTGDGFAVSDVALADPRLAGIHFTGSTATFGHLWQWVGTNI--GRYHSYPRLVGETGGKDFVVAHASARPDVLRTALIRGAFDYQGQKCSAVSRAFIAHSVWQRMGDELLA-----KAAELRYGD-IT-DLSNYGGALIDQRAFVKNVDAIERAKGAAAVTVAVGGEYDDSEGYFVRPTVLLSDDPTDESFVIEYFGPLLSVHVYPDERYEQILDVIDTGSRYALTGAVIADDRQAVLTALDRLRFAAGNFYVNDKPTGAVVGRQPFGGARGSDTNDKAGSPLNLLRWTSARSIKETFVAATDHIYPHMAVD
103 HHSearch 96.5799% -93 - C3 -4JDC ? A:[21-563] MDAITQVPVPANEPVHDYAPKSPERTR---LRTELASLADHPIDLPHVIGGRHRMGDGERIDVVQ--PHRHAARLGTLTNATHADAAAAVEAAMSAKSDWAALPFDERAAVFLRAADLLAG-PWREKIAAATMLGQSKSVYQAEIDAVC-ELIDFWRFNVAFARQILEQ-----QPI-SGPGEWNRIDYRPLDGFVYAITPFNF-TSIAGNLPTAPALMGNTVIWKPSITQTLAAYLTMQLLEAAGLPPGVINLVTGDGFAVSDVALADPRLAGIHFTGSTATFGHLWQWVGTNI--GRYHSYPRLVGETGGKDFVVAHASARPDVLRTALIRGAFDYQGQKCSAVSRAFIAHSVWQRMGDELLA-----KAAELRYGD-IT-DLSNYGGALIDQRAFVKNVDAIERAKGAAAVTVAVGGEYDDSEGYFVRPTVLLSDDPT-------YFGPLLSVHVYPDERYEQILDVIDTGSRYALTGAVIADDRQAVLTALDRLRFAAGNFYVNDKPTGAVVGRQPFGGARGSDTNDKAGSPLNLLRWTSARSIKETFVAATDHIYPHMAVD
2 PsiBlast_PDB 81.5899% -59 - C3 -4IDS - ? A:[1-542] MDAITQVPVPANEPVHDYAPKSPERTR---LRTELASLADHPIDLPHVIGGRHRMGDGERIDVVQ--PHRHAARLGTLTNATHADAAAAVEAAMSAKSDWAALPFDERAAVFLRAADLLAG-PWREKIAAATMLGQSKSVYQAEI-DAVCELIDFWRFNVAFARQILEQ-----QPI-SGPGEWNRIDYRPLDGFVYAITPFNF-TSIAGNLPTAPALMGNTVIWKPSITQTLAAYLTMQLLEAAGLPPGVINLVTGDGFAVSDVALADPRLAGIHFTGSTATFG--WQWVGTNI--GRYHSYPRLVGETGGKDFVVAHASARPDVLRTALIRGAFDYQGQKCSAVSRAFIAHSVWQRMGDELLA-----KAAELRYGD-IT-DLSNYGGALIDQRAFVKNVDAIERAKGAAAVTVAVGGEYDDSEGYFVRPTVLLSDDPTDESFVIEYFGPLLSVHVYPDERYEQILDVIDTGSRYALTGAVIADDRQAVLTALDRLRFAAGNFYVNDKPTGAVVGRQPFGGARGSDTNDKAGSPLNLLRWTSARSIKETFVAATDHIYPHMAV-
9 PsiBlast_PDB 76.9745% -88 - C3 -3V9I - AL4A1_HUMAN A:[33-562] ----------ANEPVLAFTQGSPERDA---LQKALKDLKGRMEAIPCVVGDEEVWTSDVQYQV-S--PFNHGHKVAKFCYADKSLLNKAIEAALAARKEWDLKPIADRAQIFLKAADMLSG-PRRAEILAKTMVGQGKTVIQAEI-DAAAELIDFFRFNAKYAVELEG-------------PSTNSTVYRGLEGFVAAISPFNF-TAIGGNLAGAPALMGNVVLWKPSDTAMLASYAVYRILREAGLPPNIIQFVPADGPLFGDTVTSSEHLCGINFTGSVPTFKHLWKQVAQNL--DRFHTFPRLAGECG-KNFHFVHRSADVESVVSGTLRSAFEYGGQKCSACLRLYVPHSLWPQIKGRLLE-----EHSRIKVGDPAE-DFGTFFSAVIDAKSFARIKKWLEHARSSPSLTILAGGKCDDSVGYFVEPCIVESKDPQEPIMKEEIFGPVLSVYVYPDDKYKETLQLVDSTTSYGLTGAVFSQDKDVVQEATKVLRNAAGNFYINDKST--------------------------ILRWTSPQVIKETHKPLGDWSYAYM---
37 PsiBlast_CBE 76.5245% -80 - C3 -4E3X AL4A1_MOUSE B:[33-562] ----------ANEPILAFSQGSPERDA---LQKALKDLKGQTEAIPCVVGDEEVWTSDIQYQL-S--PFNHAHKVAKFCYADKALLNRAIDAALAARKEWDLKPMADRAQVFLKAADMLSG-PRRAEVLAKTMVGQGKTVIQAEI-DAAAELIDFFRFNAKFAVELEGE-----QPI-SVPPSTNHTVYRGLEGFVAAISPFNF-TAIGGNLAGAPALMGNVVLWKPSDTAMLASYAVYRILREAGLPPNIIQFVPADGPTFGDTVTSSEHLCGINFTGSVPTFKHLWRQVAQNL--DRFRTFPRLAGECGGKNFHFVHSSADVDSVVSGTLRSAFEYGGQKCSACSRLYVPKSLWPQIKGRLLE-----EHSRIKVGDPAE-DFGTFFSAVIDAKAFARIKKWLEHARSSPSLSILAGGQCNESVGYYVEPCIIESKDPQEPIMKEEIFGPVLTVYVYPDDKYRETLKLVDSTTSYGLTGAVFAQDKAIVQEATRMLRNAAGNFYINDKSTGSVVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKETHKPLGDWRYSYM---
17 PsiBlast_PDB 76.4145% -77 - C3 -4LH2 AL4A1_MOUSE A:[33-562] ----------ANEPILAFSQGSPERDA---LQKALKDLKGQTEAIPCVVGDEEVWTSDIQYQL-S--PFNHAHKVAKFCYADKALLNRAIDAALAARKEWDLKPMADRAQVFLKAADMLSG-PRRAEVLAKTMVGQGKTVIQAEI-DAAAELIDFFRFNAKFAVELEGE-----QPI-SVPPSTNHTVYRGLEGFVAAISPFNF-TAIGGNLAGAPALMGNVVLWKPSDTAMLASYAVYRILREAGLPPNIIQFVPADGPTFGDTVTSSEHLCGINFTGSVPTFKHLWRQVAQNL--DRFRTFPRLAGECGGKNFHFVHSSADVDSVVSGTLRSAFEYGGQKCSACSRLYVPKSLWPQIKGRLLE-----EHSRIKVGDPAE-DFGTFFSAVIDAKAFARIKKWLEHARSSPSLSILAGGQCNESVGYYVEPCIIESKDPQEPIMKEEIFGPVLTVYVYPDDKYRETLKLVDSTTSYGLTGAVFAQDKAIVQEATRMLRNAAGNFYINDKSTGSVVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKETHKPLGDWRYSYM---
14 PsiBlast_PDB 76.2845% -78 - C3 -4LGZ AL4A1_MOUSE A:[33-562] ----------ANEPILAFSQGSPERDA---LQKALKDLKGQTEAIPCVVGDEEVWTSDIQYQL-S--PFNHAHKVAKFCYADKALLNRAIDAALAARKEWDLKPMADRAQVFLKAADMLSG-PRRAEVLAKTMVGQGKTVIQAEI-DAAAELIDFFRFNAKFAVELEGE-----QPI-SVPPSTNHTVYRGLEGFVAAISPFNF-TAIGGNLAGAPALMGNVVLWKPSDTAMLASYAVYRILREAGLPPNIIQFVPADGPTFGDTVTSSEHLCGINFTGSVPTFKHLWRQVAQNL--DRFRTFPRLAGECGGKNFHFVHSSADVDSVVSGTLRSAFEYGGQKCSACSRLYVPKSLWPQIKGRLLE-----EHSRIKVGDPAE-DFGTFFSAVIDAKAFARIKKWLEHARSSPSLSILAGGQCNESVGYYVEPCIIESKDPQEPIMKEEIFGPVLTVYVYPDDKYRETLKLVDSTTSYGLTGAVFAQDKAIVQEATRMLRNAAGNFYINDKSTGSVVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKETHKPLGDWRYSYM---
8 PsiBlast_PDB 76.2545% -80 - C3 -3V9H AL4A1_HUMAN A:[36-565] ----------ANEPVLAFTQGSPERDA---LQKALKDLKGRMEAIPCVVGDEEVWTSDVQYQV-S--PFNHGHKVAKFCYADKSLLNKAIEAALAARKEWDLKPIADRAQIFLKAADMLSG-PRRAEILAKTMVGQGKTVIQAEI-DAAAELIDFFRFNAKYAVELEGQ-----QPI-SVPPSTNSTVYRGLEGFVAAISPFNF-TAIGGNLAGAPALMGNVVLWKPSDTAMLASYAVYRILREAGLPPNIIQFVPADGPLFGDTVTSSEHLCGINFTGSVPTFKHLWKQVAQNL--DRFHTFPRLAGECGGKNFHFVHRSADVESVVSGTLRSAFEYGGQKCSACARLYVPHSLWPQIKGRLLE-----EHSRIKVGDPAE-DFGTFFSAVIDAKSFARIKKWLEHARSSPSLTILAGGKCDDSVGYFVEPCIVESKDPQEPIMKEEIFGPVLSVYVYPDDKYKETLQLVDSTTSYGLTGAVFSQDKDVVQEATKVLRNAAGNFYINDKSTGSIVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKETHKPLGDWSYAYM---
16 PsiBlast_PDB 76.2145% -78 - C3 -4LH1 AL4A1_MOUSE A:[33-562] ----------ANEPILAFSQGSPERDA---LQKALKDLKGQTEAIPCVVGDEEVWTSDIQYQL-S--PFNHAHKVAKFCYADKALLNRAIDAALAARKEWDLKPMADRAQVFLKAADMLSG-PRRAEVLAKTMVGQGKTVIQAEI-DAAAELIDFFRFNAKFAVELEGE-----QPI-SVPPSTNHTVYRGLEGFVAAISPFNF-TAIGGNLAGAPALMGNVVLWKPSDTAMLASYAVYRILREAGLPPNIIQFVPADGPTFGDTVTSSEHLCGINFTGSVPTFKHLWRQVAQNL--DRFRTFPRLAGECGGKNFHFVHSSADVDSVVSGTLRSAFEYGGQKCSACSRLYVPKSLWPQIKGRLLE-----EHSRIKVGDPAE-DFGTFFSAVIDAKAFARIKKWLEHARSSPSLSILAGGQCNESVGYYVEPCIIESKDPQEPIMKEEIFGPVLTVYVYPDDKYRETLKLVDSTTSYGLTGAVFAQDKAIVQEATRMLRNAAGNFYINDKSTGSVVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKETHKPLGDWRYSYM---
34 PsiBlast_CBE 76.1345% -79 - C3 -4LH1 AL4A1_MOUSE B:[33-562] ----------ANEPILAFSQGSPERDA---LQKALKDLKGQTEAIPCVVGDEEVWTSDIQYQL-S--PFNHAHKVAKFCYADKALLNRAIDAALAARKEWDLKPMADRAQVFLKAADMLSG-PRRAEVLAKTMVGQGKTVIQAEI-DAAAELIDFFRFNAKFAVELEGE-----QPI-SVPPSTNHTVYRGLEGFVAAISPFNF-TAIGGNLAGAPALMGNVVLWKPSDTAMLASYAVYRILREAGLPPNIIQFVPADGPTFGDTVTSSEHLCGINFTGSVPTFKHLWRQVAQNL--DRFRTFPRLAGECGGKNFHFVHSSADVDSVVSGTLRSAFEYGGQKCSACSRLYVPKSLWPQIKGRLLE-----EHSRIKVGDPAE-DFGTFFSAVIDAKAFARIKKWLEHARSSPSLSILAGGQCNESVGYYVEPCIIESKDPQEPIMKEEIFGPVLTVYVYPDDKYRETLKLVDSTTSYGLTGAVFAQDKAIVQEATRMLRNAAGNFYINDKSTGSVVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKETHKPLGDWRYSYM---
12 PsiBlast_PDB 76.0345% -77 - C3 -3V9L AL4A1_MOUSE A:[33-562] ----------ANEPILAFSQGSPERDA---LQKALKDLKGQTEAIPCVVGDEEVWTSDIQYQL-S--PFNHAHKVAKFCYADKALLNRAIDAALAARKEWDLKPMADRAQVFLKAADMLSG-PRRAEVLAKTMVGQGKTVIQAEI-DAAAELIDFFRFNAKFAVELEGE-----QPI-SVPPSTNHTVYRGLEGFVAAISPFNF-TAIGGNLAGAPALMGNVVLWKPSDTAMLASYAVYRILREAGLPPNIIQFVPADGPTFGDTVTSSEHLCGINFTGSVPTFKHLWRQVAQNL--DRFRTFPRLAGECGGKNFHFVHSSADVDSVVSGTLRSAFEYGGQKCSACSRLYVPKSLWPQIKGRLLE-----EHSRIKVGDPAE-DFGTFFSAVIDAKAFARIKKWLEHARSSPSLSILAGGQCNESVGYYVEPCIIESKDPQEPIMKEEIFGPVLTVYVYPDDKYRETLKLVDSTTSYGLTGAVFAQDKAIVQEATRMLRNAAGNFYINDKSTGSVVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKETHKPLGDWRYSYM---
38 PsiBlast_CBE 75.9845% -79 - C3 -3V9L AL4A1_MOUSE B:[33-562] ----------ANEPILAFSQGSPERDA---LQKALKDLKGQTEAIPCVVGDEEVWTSDIQYQL-S--PFNHAHKVAKFCYADKALLNRAIDAALAARKEWDLKPMADRAQVFLKAADMLSG-PRRAEVLAKTMVGQGKTVIQAEI-DAAAELIDFFRFNAKFAVELEGE-----QPI-SVPPSTNHTVYRGLEGFVAAISPFNF-TAIGGNLAGAPALMGNVVLWKPSDTAMLASYAVYRILREAGLPPNIIQFVPADGPTFGDTVTSSEHLCGINFTGSVPTFKHLWRQVAQNL--DRFRTFPRLAGECGGKNFHFVHSSADVDSVVSGTLRSAFEYGGQKCSACSRLYVPKSLWPQIKGRLLE-----EHSRIKVGDPAE-DFGTFFSAVIDAKAFARIKKWLEHARSSPSLSILAGGQCNESVGYYVEPCIIESKDPQEPIMKEEIFGPVLTVYVYPDDKYRETLKLVDSTTSYGLTGAVFAQDKAIVQEATRMLRNAAGNFYINDKSTGSVVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKETHKPLGDWRYSYM---
18 PsiBlast_PDB 75.9445% -79 - C3 -4LH3 AL4A1_MOUSE A:[33-562] ----------ANEPILAFSQGSPERDA---LQKALKDLKGQTEAIPCVVGDEEVWTSDIQYQL-S--PFNHAHKVAKFCYADKALLNRAIDAALAARKEWDLKPMADRAQVFLKAADMLSG-PRRAEVLAKTMVGQGKTVIQAEI-DAAAELIDFFRFNAKFAVELEGE-----QPI-SVPPSTNHTVYRGLEGFVAAISPFNF-TAIGGNLAGAPALMGNVVLWKPSDTAMLASYAVYRILREAGLPPNIIQFVPADGPTFGDTVTSSEHLCGINFTGSVPTFKHLWRQVAQNL--DRFRTFPRLAGECGGKNFHFVHSSADVDSVVSGTLRSAFEYGGQKCSACSRLYVPKSLWPQIKGRLLE-----EHSRIKVGDPAE-DFGTFFSAVIDAKAFARIKKWLEHARSSPSLSILAGGQCNESVGYYVEPCIIESKDPQEPIMKEEIFGPVLTVYVYPDDKYRETLKLVDSTTSYGLTGAVFAQDKAIVQEATRMLRNAAGNFYINDKSTGSVVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKETHKPLGDWRYSYM---
13 PsiBlast_PDB 75.8545% -79 - C3 -4E3X AL4A1_MOUSE A:[33-562] ----------ANEPILAFSQGSPERDA---LQKALKDLKGQTEAIPCVVGDEEVWTSDIQYQL-S--PFNHAHKVAKFCYADKALLNRAIDAALAARKEWDLKPMADRAQVFLKAADMLSG-PRRAEVLAKTMVGQGKTVIQAEI-DAAAELIDFFRFNAKFAVELEGE-----QPI-SVPPSTNHTVYRGLEGFVAAISPFNF-TAIGGNLAGAPALMGNVVLWKPSDTAMLASYAVYRILREAGLPPNIIQFVPADGPTFGDTVTSSEHLCGINFTGSVPTFKHLWRQVAQNL--DRFRTFPRLAGECGGKNFHFVHSSADVDSVVSGTLRSAFEYGGQKCSACSRLYVPKSLWPQIKGRLLE-----EHSRIKVGDPAE-DFGTFFSAVIDAKAFARIKKWLEHARSSPSLSILAGGQCNESVGYYVEPCIIESKDPQEPIMKEEIFGPVLTVYVYPDDKYRETLKLVDSTTSYGLTGAVFAQDKAIVQEATRMLRNAAGNFYINDKSTGSVVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKETHKPLGDWRYSYM---