@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Rv1207: (2016-04-29 )
MRSTPPASAGRSTPPALAGHSTPPALAGHSTLCGRPVAGDRALIMAIVNRTPDSFYDKGATFSDAAARDAVHRAVADGADVIDVGGVKAGPGERVDVDTEITRLVPFIEWLRGAYPDQLISVDTWRAQVAKAACAAGADLINDTWGGVDPAMPEVAAEFGAGLVCAHTGGALPRTRPFRVSYGTTTRGVVDAVISQVTAAAERAVAAGVAREKVLIDPAHDFGKNTFHGLLLLRHVADLVMTGWPVLMALSNKDVVGETLGVDLTERLEGTLAATALAAAAGARMFRVHEVAATRRVLEMVASIQGVRPPTRTVRGLA

Atome Classification :

(70 SA) .........10........20........30....-....-40-.........50........60..-......70.....-----...80........90.-.-.-.....100.......110...----....120.......130.......140.....-.-.-150......--------.-160-------.........170...-...-.180...------------------------....190.......200.......210.......220..----..-...230.......240---.----------------..--......250.......260-..------.-----..--....--------270.......280.......290.......300.......310......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MRSTPPASAGRSTPPALAGHSTPPALAGHSTLCGR-PVAG-D--RALIMAIVNRTPDSFYDKGATFS-DAAARDAVHRAVA-----DGADVIDVGGVKAGPG-E-R-VDVDTEITRLVPFIEWLRGAY----PDQLISVDTWRAQVAKAACAAGADLINDTWGG-V-D-PAMPEVAAE--------F-G---------AGLVCAHTGGALPRT-RPF-RVSYGTT------------------------TRGVVDAVISQVTAAAERAVAAGVAREKVLIDPAHDFGK----NT-FHGLLLLRHVADLV-----M----------------TG--WPVLMALSNKDVVGETL---GV------D-----LT--ERLE--------GTLAATALAAAAGARMFRVHEVAATRRVLEMVASIQGVRPPTRTVRGLA
95 HHSearch 95.42100%-143 - C6 -2VP8 DHPS2_MYCTU A:[27-311] --------------------------AGHSTLCGR-PVAG-D--RALIMAIVN---------------DAAARDAVHRAVA-----DGADVIDVG-------------DVDTEITRLVPFIEWLRGAY----PDQLISVDTWRAQVAKAACAAGADLINDTWGG-V-D-PAMPEVAAE--------F-G---------AGLVCAHT---------------YGTT------------------------TRGVVDAVISQVTAAAERAVAAGVAREKVLIDPAHDFGK----NT-FHGLLLLRHVADLV-----M----------------TG--WPVLMALS-------------------------------RLE--------GTLAATALAAAAGARMFRVHEVAATRRVLEMVASIQGVRPPT-------
1 PsiBlast_PDB 95.2199%-143 - C6 -2VP8 DHPS2_MYCTU A:[27-311] --------------------------AGHSTLCGR-PVAG-D--RALIMAIVN---------------DAAARDAVHRAVA-----DGADVIDVG-------------DVDTEITRLVPFIEWLRGAY----PDQLISVDTWRAQVAKAACAAGADLINDTWGG-V-D-PAMPEVAAE--------F-G---------AGLVCAHT---------------YGTT------------------------TRGVVDAVISQVTAAAERAVAAGVAREKVLIDPAHDFGK----NT-FHGLLLLRHVADLV-----M----------------TG--WPVLMALS-------------------------------RLE--------GTLAATALAAAAGARMFRVHEVAATRRVLEMVASIQGVRPPT-------
21 PsiBlast_CBE 91.3699%-136 - C6 -2VP8 DHPS2_MYCTU B:[29-310] ----------------------------HSTLCGR-PVAG-D--RALIMAIVNRT-------------DAAARDAVHRAVA-----DGADVIDVGG-----------VDVDTEITRLVPFIEWLRGAY----PDQLISVDTWRAQVAKAACAAGADLINDTWGG-V-D-PAMPEVAAE--------F-G---------AGLVCAHT---------------YGTT------------------------TRGVVDAVISQVTAAAERAVAAGVAREKVLIDPAHDFGK----NT-FHGLLLLRHVADLV-----M----------------TG--WPVLMALSN-----------------------------ERLE--------GTLAATALAAAAGARMFRVHEVAATRRVLEMVASIQGVRPP--------
85 Fugue 73.2836%-102 - C6 -1AD1 DHPS_STAAU A:[1-264] -----------------------------------------T--KTKIMGILNVTPDSFSDGGKFNN-VESAVTRVKAMMD-----EGADIIDVGGVSTRPGHE-M-ITVEEELNRVLPVVEAIVG------FDVKISVDTFRSEVAEACLKLGVDIINDQWAG-LYD-HRMFQVVAK--------Y-D---------AEIVLMHN-GNGNRD-------------------------------------EPVVEEMLTSLLAQAHQAKIAGIPSNKIWLDPGIGFAK----TR-NEEAEVMARLDELV-----A----------------TE--YPVLLATSRKRFTKEMM---GY------DTT---PV--ERDE--------VTAATTAYGIMKGVRAVRVHNVELNAKLAKGIDFLKENENA-RHN----
65 PsiBlast_CBE 72.4037%-104 - C6 -1AD1 DHPS_STAAU A:[2-242] --------------------------------------------KTKIMGILNVTPDSFSDGGKFNN-VESAVTRVKAMMD-----EGADIIDVGGVSTRPGHE-M-ITVEEELNRVLPVVEAIVGF------DVKISVDTFRSEVAEACLKLGVDIINDQWAG-LYD-HRMFQVVAK--------Y-D---------AEIVLMHNGN--------------GNR------------------------DEPVVEEMLTSLLAQAHQAKIAGIPSNKIWLDPGIGFAK----TR-NEEAEVMARLDELV-----A----------------TE--YPVLLATSRKRFTKEMM---GY------D-----TTPVERDE--------VTAATTAYGIMKGVRAVRVHNV---------------------------
97 HHSearch 71.1830% -90 - C6 -2BMB FOL1_YEAST A:[221-543] --------------------------------------TV-S--PTYIMAIFNATPDSFSDGGEHFADIESQLNDIIKLCKDALYLHESVIIDVGGCSTRPN-SIQ-ASEEEEIRRSIPLIKAIRESTELPQDKVILSIDTYRSNVAKEAIKVGVDIINDISGG-LFD-SNMFAVIAE--------NPE---------ICYILSHTRGD-IST-MNR-LAHYENFALGDSIQQEFVHNTDIQQLDDLKDKTVLIRNVGQEIGERYIKAIDNGVKRWQILIDPGLGFAK----TW-KQNLQIIRHIPILK-----NYSFTMNSNNSQVYVNLRN--MPVLLGPSRKKFIGHIT---KD------VD----AK--QRDF--------ATGAVVASCIGFGSDMVRVHDVKNCSKSIKLADAIYKG-----------
14 PsiBlast_PDB 70.9834% -96 - C6 -3H2E ? A:[37-293] ---------------------------------------N-E--KTLIMGILNVTPDSFSDGGSYNEVDAAVRHA-KEMRD-----EGAHIIDIGGESTRPGFA-K-VSVEEEIKRVVPMIQAVSKEV----K-LPISIDTYKAEVAKQAIEAGAHIINDIWGAKA-E-PKIAEVAAH--------Y-D---------VPIILMHNRDNM--------------N------------------------YRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAK----TP-EQNLEAMRNLEQLN-----V----------------LG--YPVLLGTSRKSFIGHVL---DL------P-----VE--ERLE--------GTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIG------------
103 HHSearch 70.4835%-104 * C6 *4HB7 DHPS_STAAM A:[5-264] -----------------------------------------T--KTKIMGILNVT----------NN-VETAINRVKAMID-----EGADIIDVGGVSTRPG-HEM-VTLEEELNRVLPVVEAIVG------FDVKISVDTFRSEVAEACLKLGVDMINDQWAG-LYD-HRMFQIVAK--------Y-D---------AEIILMHNGNGNRDE--------------------------------------PVVEEMLTSLLAQAHQAKIAGIPSNKIWLDPGIGFAK----TR-NEEAEVMARLDELV-----A----------------TE--YPVLLATSRKRFTKEMM---GYDT----T-----PV--ERDE--------VTAATTAYGIMKGVRAVRVHNVELNAKLAKGIDFLKENEN---------
2 PsiBlast_PDB 70.4534% -95 - C6 -1TWS ? A:[37-293] ---------------------------------------N-E--KTLIMGILNVTPDSFSDGGSYNEVDAAVRHA-KEMRD-----EGAHIIDIGGESTRPGFA-K-VSVEEEIKRVVPMIQAVSKEV----K-LPISIDTYKAEVAKQAIEAGAHIINDIWGAKA-E-PKIAEVAAH--------Y-D---------VPIILMHNRDNM--------------N------------------------YRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAK----TP-EQNLEAMRNLEQLN-----V----------------LG--YPVLLGTSRKSFIGHVL---DL------P-----VE--ERLE--------GTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIG------------
98 HHSearch 70.2334% -97 - C6 -4NIR ? A:[27-294] -----------------------------LRCGEY-TLNLNE--KTLIMGILNVTPDSFSDGGSYNE-VDAAVRHAKEMRD-----EGAHIIDIGGESTRPG-FAK-VSVEEEIKRVVPMIQAVSKE-----VKLPISIDTYKAEVAKQAIEAGAHIINDIWGA-K-AEPKIAEVAAH--------Y-D---------VPIILMHNRDN-M---------NYR----------------------------NLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAK----TP-EQNLEAMRNLEQLN-----V----------------LG--YPVLLGTSRKSFIGHVL---DL------P-----VE--ERLE--------GTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK-----------
27 PsiBlast_CBE 70.2334%-107 - C6 -4NHV ? B:[37-293] ---------------------------------------N-E--KTLIMGILNVTP---SDGGSYNEVDAAVRHA-KEMRD-----EGAHIIDIGGES---------VSVEEEIKRVVPMIQAVSKEV----K-LPISIDTYKAEVAKQAIEAGAHIINDIWGAKA-E-PKIAEVAAH--------Y-D---------VPIILMHNRDNM--------------N------------------------YRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAK----TP-EQNLEAMRNLEQLN-----V----------------LG--YPVLLGTSRKSFIGHVL---DL------P-----VE--ERLE--------GTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIG------------
6 PsiBlast_PDB 70.1034%-102 - C6 -1TX2 ? A:[37-293] ---------------------------------------N-E--KTLIMGILNVTPDSFSDGGSYNEVDAAVRHA-KEMRD-----EGAHIIDIGGES----FA-K-VSVEEEIKRVVPMIQAVSKEV----K-LPISIDTYKAEVAKQAIEAGAHIINDIWGAKA-E-PKIAEVAAH--------Y-D---------VPIILMHNRDNM--------------N------------------------YRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAK----TP-EQNLEAMRNLEQLN-----V----------------LG--YPVLLGTSRKSFIGHVL---DL------P-----VE--ERLE--------GTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIG------------
52 PsiBlast_CBE 69.9634%-106 - C6 -3H2A ? B:[37-293] ---------------------------------------N-E--KTLIMGILNVTP-----GGSYNEVDAAVRHA-KEMRD-----EGAHIIDIGGEST--------VSVEEEIKRVVPMIQAVSKEV----K-LPISIDTYKAEVAKQAIEAGAHIINDIWGAKA-E-PKIAEVAAH--------Y-D---------VPIILMHNRDNM--------------N------------------------YRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAK----TP-EQNLEAMRNLEQLN-----V----------------LG--YPVLLGTSRKSFIGHVL---DL------P-----VE--ERLE--------GTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIG------------
26 PsiBlast_CBE 69.8934% -94 - C6 -4NIL ? A:[37-293] ---------------------------------------N-E--KTLIMGILNVTPDSFSDGGSYNEVDAAVRHA-KEMRD-----EGAHIIDIGGESTRPGFA-K-VSVEEEIKRVVPMIQAVSKEV----K-LPISIDTYKAEVAKQAIEAGAHIINDIWGAKA-E-PKIAEVAAH--------Y-D---------VPIILMHNRDNM--------------N------------------------YRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAK----TP-EQNLEAMRNLEQLN-----V----------------LG--YPVLLGTSRKSFIGHVL---DL------P-----VE--ERLE--------GTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIG------------
24 PsiBlast_CBE 69.8734% -97 - C6 -4NIR ? A:[37-293] ---------------------------------------N-E--KTLIMGILNVTPDSFSDGGSYNEVDAAVRHA-KEMRD-----EGAHIIDIGGESTRPGFA-K-VSVEEEIKRVVPMIQAVSKEV----K-LPISIDTYKAEVAKQAIEAGAHIINDIWGAKA-E-PKIAEVAAH--------Y-D---------VPIILMHNRDNM--------------N------------------------YRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAK----TP-EQNLEAMRNLEQLN-----V----------------LG--YPVLLGTSRKSFIGHVL---DL------P-----VE--ERLE--------GTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIG------------
41 PsiBlast_CBE 69.8434%-105 - C6 -3TYE ? B:[37-293] ---------------------------------------N-E--KTLIMGILNV-------GGSYNEVDAAVRHA-KEMRD-----EGAHIIDIGGEST---------SVEEEIKRVVPMIQAVSKEV----K-LPISIDTYKAEVAKQAIEAGAHIINDIWGAKA-E-PKIAEVAAH--------Y-D---------VPIILMHNRDNM--------------N------------------------YRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAK----TP-EQNLEAMRNLEQLN-----V----------------LG--YPVLLGTSRKSFIGHVL---DL------P-----VE--ERLE--------GTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIG------------
69 PsiBlast_CBE 69.7833% -91 - C6 -3TZF ? B:[4-279] -----------------------------MHLTAR-GLTL-DLSRPQVMGILNVTPDSFSDGGCHNN-LDQALQHAQRMLS-----AGATLIDIGGESTRPG---E-VSEQEELDRVVPVVEALAQRF-----DVWLSVDTSKAAVITESAHAGAHLINDIRSL-Q-E-PGALEAAAK--------T-G---------LPVCLMHMQG------QPK-NMQHSPY------------------------YDDLMTDINRFFQHHIERCVAAGIAKNKLLLDPGFGFGK----NL-AHNYQLLAHLSELH-----H----------------FE--LPLLVGMSRKSMVGQLL---NV------P-----PQ--QRVI--------GSVACAVIAAMQGAQIIRVHDVKETVEAMCIVEA-------TRSAK---
25 PsiBlast_CBE 69.7334%-108 - C6 -4NIL ? B:[37-293] ---------------------------------------N-E--KTLIMGILNVTP---SDGGSYNEVDAAVRHA-KEMRD-----EGAHIIDIGG-------A-K-VSVEEEIKRVVPMIQAVSKEV----K-LPISIDTYKAEVAKQAIEAGAHIINDIWGAKA-E-PKIAEVAAH--------Y-D---------VPIILMHNRDNM--------------N------------------------YRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAK----TP-EQNLEAMRNLEQLN-----V----------------LG--YPVLLGTSRKSFIGHVL---DL------P-----VE--ERLE--------GTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIG------------
39 PsiBlast_CBE 69.7134%-111 - C6 -4D8A ? B:[37-293] ---------------------------------------N-E--KTLIMGILN----------SYNEVDAAVRHA-KEMRD-----EGAHIIDIG-------------SVEEEIKRVVPMIQAVSKEV----K-LPISIDTYKAEVAKQAIEAGAHIINDIWGAKA-E-PKIAEVAAH--------Y-D---------VPIILMHNRDNM--------------N------------------------YRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAK----TP-EQNLEAMRNLEQLN-----V----------------LG--YPVLLGTSRKSFIGHVL---DL------P-----VE--ERLE--------GTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIG------------
34 PsiBlast_CBE 69.6134%-115 - C6 -4DAF ? A:[37-293] ---------------------------------------N-E--KTLIMGILN----------SYNEVDAAVRHA-KEMRD-----EGAHIIDIG-------------SVEEEIKRVVPMIQAVSKEV----K-LPISIDTYKAEVAKQAIEAGAHIINDIWGAKA-E-PKIAEVAAH--------Y-D---------VPIILMHNRDNM--------------N------------------------YRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAK----TP-EQNLEAMRNLEQLN-----V----------------LG--YPVLLGTSRKSFIGHVL---DL------P-----VE--ERLE--------GTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIG------------
13 PsiBlast_PDB 69.5834%-106 - C6 -3H2C ? A:[37-293] ---------------------------------------N-E--KTLIMGILN---------GSYNEVDAAVRHA-KEMRD-----EGAHIIDIG-ESTR--------SVEEEIKRVVPMIQAVSKEV----K-LPISIDTYKAEVAKQAIEAGAHIINDIWGAKA-E-PKIAEVAAH--------Y-D---------VPIILMHNRDNM--------------N------------------------YRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAK----TP-EQNLEAMRNLEQLN-----V----------------LG--YPVLLGTSRKSFIGHVL---DL------P-----VE--ERLE--------GTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIG------------
5 PsiBlast_PDB 69.5834%-105 - C6 -1TX0 ? A:[37-293] ---------------------------------------N-E--KTLIMGILNVTPDSFSDGGSYNEVDAAVRHA-KEMRD-----EGAHIIDIGG---------K-VSVEEEIKRVVPMIQAVSKEV----K-LPISIDTYKAEVAKQAIEAGAHIINDIWGAKA-E-PKIAEVAAH--------Y-D---------VPIILMHNRDNM--------------N------------------------YRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAK----TP-EQNLEAMRNLEQLN-----V----------------LG--YPVLLGTSRKSFIGHVL---DL------P-----VE--ERLE--------GTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIG------------
70 PsiBlast_CBE 69.5633% -88 - C6 -3TZF ? A:[4-278] -----------------------------MHLTAR-GLTL-DLSRPQVMGILNVTPDSFSDGGCHNN-LDQALQHAQRMLS-----AGATLIDIGGESTRPG-AAE-VSEQEELDRVVPVVEALAQRF-----DVWLSVDTSKAAVITESAHAGAHLINDIRSL-Q-E-PGALEAAAK--------T-G---------LPVCLMHMQG------QPK-NMQHSPY------------------------YDDLMTDINRFFQHHIERCVAAGIAKNKLLLDPGFGFGK----NL-AHNYQLLAHLSELH-----H----------------FE--LPLLVGMSRKSMVGQLL---NV------P-----PQ--QRVI--------GSVACAVIAAMQGAQIIRVHDVKETVEAMCIVEA-------TRSA----
44 PsiBlast_CBE 69.5134%-102 - C6 -3TYD ? A:[37-293] ---------------------------------------N-E--KTLIMGILNVTPDSFS--GSYNEVDAAVRHA-KEMRD-----EGAHIIDIGGESTRPGFA-K-VSVEEEIKRVVPMIQAVSKEV----K-LPISIDTYKAEVAKQAIEAGAHIINDIWGAKA-E-PKIAEVAAH--------Y-D---------VPIILMHNRDNM--------------N------------------------YRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAK----TP-EQNLEAMRNLEQLN-----V----------------LG--YPVLLGTSRKSFIGHVL---DL------P-----VE--ERLE--------GTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIG------------