@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Rv1240: (2016-04-29 )
MSASPLKVAVTGAAGQIGYSLLFRLASGSLLGPDRPIELRLLEIEPALQALEGVVMELDDCAFPLLSGVEIGSDPQKIFDGVSLALLVGARPRGAGMERSDLLEANGAIFTAQGKALNAVAADDVRVGVTGNPANTNALIAMTNAPDIPRERFSALTRLDHNRAISQLAAKTGAAVTDIKKMTIWGNHSATQYPDLFHAEVAGKNAAEVVNDQAWIEDEFIPTVAKRGAAIIDARGASSAASAASATIDAARDWLLGTPADDWVSMAVVSDGSYGVPEGLISSFPVTTKGGNWTIVSGLEIDEFSRGRIDKSTAELADERSAVTELGLI

Atome Classification :

(29 SA) .........10........20........30........40...--.....50........60........70.......-.80........90........100.......110.......120..-.....130.......140....-...150.......160.......170.......180.......190.......200..----.....210.......220.......230.......240.......250.......260.......270.-.-......280......-.290........300.......310.......320.......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MSASPLKVAVTGAAGQIGYSLLFRLASGSLLGPDRPIELRLLEI--EPALQALEGVVMELDDCAFPLLSGVEIGSDPQKI-FDGVSLALLVGARPRGAGMERSDLLEANGAIFTAQGKALNAVAADD-VRVGVTGNPANTNALIAMTNAP-DIPRERFSALTRLDHNRAISQLAAKTGAAVTDIKKMTIWGNHSATQYPDLFHAEVAGK----NAAEVVNDQAWIEDEFIPTVAKRGAAIIDARGASSAASAASATIDAARDWLLGTPADDWVSMAVVSD-G-S-YGVPEGLISSFPVTT-KG-GNWTIVSGLEIDEFSRGRIDKSTAELADERSAVTELGLI
1 PsiBlast_PDB 98.4799% -92 - C4 -4TVO MDH_MYCTU A:[3-329] --ASPLKVAVTGAAGQIGYSLLFRLASGSLLGPDRPIELRLLEI--EPALQALEGVVMELDDCAFPLLSGVEIGSDPQKI-FDGVSLALLVGARPRGAGMERSDLLEANGAIFTAQGKALNAVAADD-VRVGVTGNPANTNALIAMTNAP-DIPRERFSALTRLDHNRAISQLAAKTGAAVTDIKKMTIWGNHSATQYPDLFHAEVAGK----NAAEVVNDQAWIEDEFIPTVAKRGAAIIDARGASSAASAASATIDAARDWLLGTPADDWVSMAVVSD-G-S-YGVPEGLISSFPVTT-KG-GNWTIVSGLEIDEFSRGRIDKSTAELADERSAVTELGLI
49 HHSearch 98.05100% -91 - C4 -4TVO MDH_MYCTU A:[3-328] --ASPLKVAVTGAAGQIGYSLLFRLASGSLLGPDRPIELRLLEI--EPALQALEGVVMELDDCAFPLLSGVEIGSDPQKI-FDGVSLALLVGARPRGAGMERSDLLEANGAIFTAQGKALNAVAADD-VRVGVTGNPANTNALIAMTNAP-DIPRERFSALTRLDHNRAISQLAAKTGAAVTDIKKMTIWGNHSATQYPDLFHAEVAGK----NAAEVVNDQAWIEDEFIPTVAKRGAAIIDARGASSAASAASATIDAARDWLLGTPADDWVSMAVVSD-G-S-YGVPEGLISSFPVTT-KG-GNWTIVSGLEIDEFSRGRIDKSTAELADERSAVTELGL-
21 PsiBlast_CBE 97.2799% -98 - C4 -4TVO MDH_MYCTU B:[4-329] ---SPLKVAVTGAAGQIGYSLLFRLASGSLLGPDRPIELRLLEI--EPALQALEGVVMELDDCAFPLLSGVEIGSDPQKI-FDGVSLALLVGARP---------LLEANGAIFTAQGKALNAVAADD-VRVGVTGNPANTNALIAMTNAP-DIPRERFSALTRLDHNRAISQLAAKTGAAVTDIKKMTIWGNHSATQYPDLFHAEVAGK----NAAEVVNDQAWIEDEFIPTVAKRGAAIIDARGASSAASAASATIDAARDWLLGTPADDWVSMAVVSD-G-S-YGVPEGLISSFPVTT-KG-GNWTIVSGLEIDEFSRGRIDKSTAELADERSAVTELGLI
6 PsiBlast_PDB 89.9363% -96 - C4 -2CVQ MDH_THETH A:[3-327] ---APVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPVILQLLEI--PQAMKALEGVVMELEDCAFPLLAGLEATDDPKVA-FKDADYALLVGAAPRKAGMERRDLLQVNGKIFTEQGRALAEVAKKD-VKVLVVGNPANTNALIAYKNAP-GLNPRNFTAMTRLDHNRAKAQLAKKTGTGVDRIRRMTVWGNHSSTMFPDLFHAEVDGR----PALELV-DMEWYEKVFIPTVAQRGAAIIQARGASSAASAANAAIEHIRDWALGTPEGDWVSMAVPSQ-G-E-YGIPEGIVYSFPVTA-KD-GAYRVVEGLEINEFARKRMEITAQELLDEMEQVKALGLI
48 HHSearch 89.8063% -94 - C4 -1Y7T MDH_THETH A:[1-326] -MKAPVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPVILQLLEI--PQAMKALEGVVMELEDCAFPLLAGLEATDDPKVA-FKDADYALLVGAAPRKAGMERRDLLQVNGKIFTEQGRALAEVAKKD-VKVLVVGNPANTNALIAYKNAP-GLNPRNFTAMTRLDHNRAKAQLAKKTGTGVDRIRRMTVWGNHSSTMFPDLFHAEVDGR----PALELV-DMEWYEKVFIPTVAQRGAAIIQARGASSAASAANAAIEHIRDWALGTPEGDWVSMAVPSQ-G-E-YGIPEGIVYSFPVTA-KD-GAYRVVEGLEINEFARKRMEITAQELLDEMEQVKALGL-
5 PsiBlast_PDB 89.7363% -97 - C4 -1Y7T MDH_THETH A:[3-327] ---APVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPVILQLLEI--PQAMKALEGVVMELEDCAFPLLAGLEATDDPKVA-FKDADYALLVGAAPRKAGMERRDLLQVNGKIFTEQGRALAEVAKKD-VKVLVVGNPANTNALIAYKNAP-GLNPRNFTAMTRLDHNRAKAQLAKKTGTGVDRIRRMTVWGNHSSTMFPDLFHAEVDGR----PALELV-DMEWYEKVFIPTVAQRGAAIIQARGASSAASAANAAIEHIRDWALGTPEGDWVSMAVPSQ-G-E-YGIPEGIVYSFPVTA-KD-GAYRVVEGLEINEFARKRMEITAQELLDEMEQVKALGLI
26 PsiBlast_CBE 89.6463% -97 - C4 -1Y7T MDH_THETH B:[3-327] ---APVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPVILQLLEI--PQAMKALEGVVMELEDCAFPLLAGLEATDDPKVA-FKDADYALLVGAAPRKAGMERRDLLQVNGKIFTEQGRALAEVAKKD-VKVLVVGNPANTNALIAYKNAP-GLNPRNFTAMTRLDHNRAKAQLAKKTGTGVDRIRRMTVWGNHSSTMFPDLFHAEVDGR----PALELV-DMEWYEKVFIPTVAQRGAAIIQARGASSAASAANAAIEHIRDWALGTPEGDWVSMAVPSQ-G-E-YGIPEGIVYSFPVTA-KD-GAYRVVEGLEINEFARKRMEITAQELLDEMEQVKALGLI
2 PsiBlast_PDB 89.4563% -95 - C4 -4KDE - MDH_THETH A:[3-327] ---APVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPVILQLLEI--PQAMKALEGVVMELEDCAFPLLAGLEATDDPKVA-FKDADYALLVGAAPRKAGMERRDLLQVNGKIFTEQGRALAEVAKKD-VKVLVVGNPANTNALIAYKNAP-GLNPRNFTAMTRLDHNRAKAQLAKKTGTGVDRIRRMTVWGNHSSTMFPDLFHAEVDGR----PALELV-DMEWYEKVFIPTVAQRGAAIIQARGASSAASAANAAIEHIRDWALGTPEGDWVSMAVPSQ-G-E-YGIPEGIVYSFPVTA-KD-GAYRVVEGLEINEFARKRMEITAQELLDEMEQVKALGLI
30 PsiBlast_CBE 89.3263% -96 - C4 -1WZE MDH_THETH B:[3-327] ---APVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPVILQLLGS--ERSFQALEGVVMELEDCAFPLLAGLEATDDPKVA-FKDADYALLVGAAPRKAGMERRDLLQVNGKIFTEQGRALAEVAKKD-VKVLVVGNPANTNALIAYKNAP-GLNPRNFTAMTRLDHNRAKAQLAKKTGTGVDRIRRMTVWGNHSSTMFPDLFHAEVDGR----PALELV-DMEWYEKVFIPTVAQRGAAIIQARGASSAASAANAAIEHIRDWALGTPEGDWVSMAVPSQ-G-E-YGIPEGIVYSFPVTA-KD-GAYRVVEGLEINEFARKRMEITAQELLDEMEQVKALGLI
25 PsiBlast_CBE 89.1863% -97 - C4 -2CVQ MDH_THETH B:[3-327] ---APVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPVILQLLEI--PQAMKALEGVVMELEDCAFPLLAGLEATDDPKVA-FKDADYALLVGAAPRKAGMERRDLLQVNGKIFTEQGRALAEVAKKD-VKVLVVGNPANTNALIAYKNAP-GLNPRNFTAMTRLDHNRAKAQLAKKTGTGVDRIRRMTVWGNHSSTMFPDLFHAEVDGR----PALELV-DMEWYEKVFIPTVAQRGAAIIQARGASSAASAANAAIEHIRDWALGTPEGDWVSMAVPSQ-G-E-YGIPEGIVYSFPVTA-KD-GAYRVVEGLEINEFARKRMEITAQELLDEMEQVKALGLI
27 PsiBlast_CBE 88.8863% -95 - C4 -1BMD MDH_THETH B:[3-327] ---APVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPVILQLLEI--PQAMKALEGVVMELEDCAFPLLAGLEATDDPDVA-FKDADYALLVGAAPRKAGMERRDLLQVNGKIFTEQGRALAEVAKKD-VKVLVVGNPANTNALIAYKNAP-GLNPRNFTAMTRLDHNRAKAQLAKKTGTGVDRIRRMTVWGNHSSTMFPDLFHAEVDGR----PALELV-DMEWYEKVFIPTVAQRGAAIIQARGASSAASAANAAIEHIRDWALGTPEGDWVSMAVPSQ-G-E-YGIPEGIVYSFPVTA-KD-GAYRVVEGLEINEFARKRMEITAQELLDEMEQVKALGLI
7 PsiBlast_PDB 88.8863% -95 - C4 -1BMD MDH_THETH A:[3-327] ---APVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPVILQLLEI--PQAMKALEGVVMELEDCAFPLLAGLEATDDPDVA-FKDADYALLVGAAPRKAGMERRDLLQVNGKIFTEQGRALAEVAKKD-VKVLVVGNPANTNALIAYKNAP-GLNPRNFTAMTRLDHNRAKAQLAKKTGTGVDRIRRMTVWGNHSSTMFPDLFHAEVDGR----PALELV-DMEWYEKVFIPTVAQRGAAIIQARGASSAASAANAAIEHIRDWALGTPEGDWVSMAVPSQ-G-E-YGIPEGIVYSFPVTA-KD-GAYRVVEGLEINEFARKRMEITAQELLDEMEQVKALGLI
29 PsiBlast_CBE 88.7963% -94 - C4 -1WZI MDH_THETH B:[3-327] ---APVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPVILQLLGS--ERSFQALEGVVMELEDCAFPLLAGLEATDDPKVA-FKDADYALLVGAAPRKAGMERRDLLQVNGKIFTEQGRALAEVAKKD-VKVLVVGNPANTNALIAYKNAP-GLNPRNFTAMTRLDHNRAKAQLAKKTGTGVDRIRRMTVWGNHSSTMFPDLFHAEVDGR----PALELV-DMEWYEKVFIPTVAQRGAAIIQARGASSAASAANAAIEHIRDWALGTPEGDWVSMAVPSQ-G-E-YGIPEGIVYSFPVTA-KD-GAYRVVEGLEINEFARKRMEITAQELLDEMEQVKALGLI
10 PsiBlast_PDB 88.4863% -94 - C4 -1WZI MDH_THETH A:[3-327] ---APVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPVILQLLGS--ERSFQALEGVVMELEDCAFPLLAGLEATDDPKVA-FKDADYALLVGAAPRKAGMERRDLLQVNGKIFTEQGRALAEVAKKD-VKVLVVGNPANTNALIAYKNAP-GLNPRNFTAMTRLDHNRAKAQLAKKTGTGVDRIRRMTVWGNHSSTMFPDLFHAEVDGR----PALELV-DMEWYEKVFIPTVAQRGAAIIQARGASSAASAANAAIEHIRDWALGTPEGDWVSMAVPSQ-G-E-YGIPEGIVYSFPVTA-KD-GAYRVVEGLEINEFARKRMEITAQELLDEMEQVKALGLI
9 PsiBlast_PDB 88.4563% -96 - C4 -1WZE MDH_THETH A:[3-327] ---APVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPVILQLLGS--ERSFQALEGVVMELEDCAFPLLAGLEATDDPKVA-FKDADYALLVGAAPRKAGMERRDLLQVNGKIFTEQGRALAEVAKKD-VKVLVVGNPANTNALIAYKNAP-GLNPRNFTAMTRLDHNRAKAQLAKKTGTGVDRIRRMTVWGNHSSTMFPDLFHAEVDGR----PALELV-DMEWYEKVFIPTVAQRGAAIIQARGASSAASAANAAIEHIRDWALGTPEGDWVSMAVPSQ-G-E-YGIPEGIVYSFPVTA-KD-GAYRVVEGLEINEFARKRMEITAQELLDEMEQVKALGLI
28 PsiBlast_CBE 88.2463% -97 - C4 -1BDM MDH_THETH B:[3-327] ---APVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPVILQLLEI--PQAMKALEGVVMELEDCAFPLLAGLEATDDPDVA-FKDADYALLVGAAPRKAGMERRDLLQVNGKIFTEQGRALAEVAKKD-VKVLVVGNPANTNALIAYKNAP-GLNPRNFTAMTRLDHNRAKAQLAKKTGTGVDRIRRMTVWGNHSSIMFPDLFHAEVDGR----PALELV-DMEWYEKVFIPTVAQRGAAIIQARGASSAASAANAAIEHIRDWALGTPEGDWVSMAVPSQ-G-E-YGIPEGIVYSFPVTA-KD-GAYRVVEGLEINEFARKRMEITAQELLDEMEQVKALGLI
3 PsiBlast_PDB 88.0163% -97 - C4 -4KDF MDH_THETH A:[3-326] ---APVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPVILQLLEI--PQAMKALEGVVMELEDCAFPLLAGLEATDDPKVA-FKDADYALLVGAAP---------LLQVNGKIFTEQGRALAEVAKKD-VKVLVVGNPANTNALIAYKNAP-GLNPRNFTAMTRLDHNRAKAQLAKKTGTGVDRIRRMTVWGNHSSTMFPDLFHAEVDGR----PALELV-DMEWYEKVFIPTVAQRGAAIIQARGASSAASAANAAIEHIRDWALGTPEGDWVSMAVPSQ-G-E-YGIPEGIVYSFPVTA-KD-GAYRVVEGLEINEFARKRMEITAQELLDEMEQVKALGL-
4 PsiBlast_PDB 87.9863% -95 - C4 -1IZ9 - MDH_THETH A:[3-327] ---APVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPVILQLLEI--PQAMKALEGVVMELEDCAFPLLAGLEATDDPKVA-FKDADYALLVGAAPRKAGMERRDLLQVNGKIFTEQGRALAEVAKKD-VKVLVVGNPANTNALIAYKNAP-GLNPRNFTAMTRLDHNRAKAQLAKKTGTGVDRIRRMTVWGNHSSTMFPDLFHAEVDGR----PALELV-DMEWYEKVFIPTVAQRGAAIIQARGASSAASAANAAIEHIRDWALGTPEGDWVSMAVPSQ-G-E-YGIPEGIVYSFPVTA-KD-GAYRVVEGLEINEFARKRMEITAQELLDEMEQVKALGLI
23 PsiBlast_CBE 87.4363% -97 - C4 -4KDF MDH_THETH C:[3-326] ---APVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPVILQLLEI--PQAMKALEGVVMELEDCAFPLLAGLEATDDPKVA-FKDADYALLVGAAPR--------LLQVNGKIFTEQGRALAEVAKKD-VKVLVVGNPANTNALIAYKNAP-GLNPRNFTAMTRLDHNRAKAQLAKKTGTGVDRIRRMTVWGNHSSTMFPDLFHAEVDGR----PALELV-DMEWYEKVFIPTVAQRGAAIIQARGASSAASAANAAIEHIRDWALGTPEGDWVSMAVPSQ-G-E-YGIPEGIVYSFPVTA-KD-GAYRVVEGLEINEFARKRMEITAQELLDEMEQVKALGL-
22 PsiBlast_CBE 87.1163% -99 - C4 -4KDF MDH_THETH D:[3-326] ---APVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPVILQLLEI--PQAMKALEGVVMELEDCAFPLLAGLEATDDPKVA-FKDADYALLVGAAPR--------LLQVNGKIFTEQGRALAEVAKKD-VKVLVVGNPANTNALIAYKNAP-GLNPRNFTAMTRLDHNRAKAQLAKKTGTGVDRIRRMTVWGNHSSTMFPDLFHAEVDGR----PALELV-DMEWYEKVFIPTVAQRGAAIIQARGASSAASAANAAIEHIRDWALGTPEGDWVSMAVPSQ-G-E-YGIPEGIVYSFPVTA-KD-GAYRVVEGLEINEFARKRMEITAQELLDEMEQVKALGL-
12 PsiBlast_PDB 85.5658% -88 - C4 -1B8U MDH_AQUAR A:[3-327] --KTPMRVAVTGAAGQICYSLLFRIANGDMLGKDQPVILQLLEIPNEKAQKALQGVMMEIDDCAFPLLAGMTAHADPMTA-FKDADVALLVGARPRGPGMERKDLLEANAQIFTVQGKAIDAVASRN-IKVLVVGNPANTNAYIAMKSAP-SLPAKNFTAMLRLDHNRALSQIAAKTGKPVSSIEKLFVWGNHSPTMYADYRYAQIDGA----SVKDMINDDAWNRDTFLPTVGKRGAAIIDARGVSSAASAANAAIDHIHDWVLGT-AGKWTTMGIPSD-G-S-YGIPEGVIFGFPVTT-EN-GEYKIVQGLSIDAFSQERINVTLNELLEEQNGVQHL---
13 PsiBlast_PDB 84.8858% -88 - C4 -1B8V MDH_AQUAR A:[3-327] --KTPMRVAVTGAAGQICYSLLFRIANGDMLGKDQPVILQLLEIPNEKAQKALQGVMMEIDDCAFPLLAGMTAHADPMTA-FKDADVALLVGARPRGPGMERKDLLEANAQIFTVQGKAIDAVASRN-IKVLVVGNPANTNAYIAMKSAP-SLPAKNFTAMLRLDHNRALSQIAAKTGKPVSSIEKLFVWGNHSPTMYADYRYAQIDGA----SVKDMINDDAWNRDTFLPTVGKRGAAIIDARGVSSAASAANAAIDHIHDWVLGT-AGKWTTMGIPSD-G-S-YGIPEGVIFGFPVTT-EN-GEYKIVQGLSIDAFSQERINVTLNELLEEQNGVQHL---
32 PsiBlast_CBE 83.2852% -83 - C4 -5MDH MDHC_PIG B:[1-329] --SEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDI--TPMMGVLDGVLMELQDCALPLLKDV-IATDKEEIAFKDLDVAILVGSMPRRDGMERKDLLKANVKIFKCQGAALDKYAKKS-VKVIVVGNPANTNCLTASKSAP-SIPKENFSCLTRLDHNRAKAQIALKLGVTSDDVKNVIIWGNHSSTQYPDVNHAKVKLQAKEVGVYEAVKDDSWLKGEFITTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGIISD-GNS-YGVPDDLLYSFPVTI-KD-KTWKIVEGLPINDFSREKMDLTAKELAEEKETAFEF---
16 PsiBlast_PDB 82.5952% -87 - C4 -4MDH MDHC_PIG A:[1-329] --SEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDI--TPMMGVLDGVLMELQDCALPLLKDV-IATDKEEIAFKDLDVAILVGSMPRRDGMERKDLLKANVKIFKCQGAALDKYAKKS-VKVIVVGNPANTNCLTASKSAP-SIPKENFSCLTRLDHNRAKAQIALKLGVTSDDVKNVIIWGNHSSTQYPDVNHAKVKLQAKEVGVYEAVKDDSWLKGEFITTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGIISD-GNS-YGVPDDLLYSFPVTI-KD-KTWKIVEGLPINDFSREKMDLTAKELAEEKETAFEF---