@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Rv1438: (2016-05-01 )
MSRKPLIAGNWKMNLNHYEAIALVQKIAFSLPDKYYDRVDVAVIPPFTDLRSVQTLVDGDKLRLTYGAQDLSPHDSGAYTGDVSGAFLAKLGCSYVVVGHSERRTYHNEDDALVAAKAATALKHGLTPIVCIGEHLDVREAGNHVAHNIEQLRGSLAGLLAEQIGSVVIAYEPVWAIGTGRVASAADAQEVCAAIRKELASLASPRIADTVRVLYGGSVNAKNVGDIVAQDDVDGGLVGGASLDGEHFATLAAIAAGGPLP

Atome Classification :

(59 SA) .........10........20......-..30......--..40........50......-..60........70........80........90........100.......110.......120.......130.......140.......--150.......160--.......170.......180.......190.......200--...--....210.......220.......230.......240.......250.......260
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MSRKPLIAGNWKMNLNHYEAIALVQKI-AFSLPDKYYD--RVDVAVIPPFTDLRSVQTLV-DGDKLRLTYGAQDLSPHDSGAYTGDVSGAFLAKLGCSYVVVGHSERRTYHNEDDALVAAKAATALKHGLTPIVCIGEHLDVREAGNHVAHNI--EQLRGSLAGLLAE--QIGSVVIAYEPVWAIGTGRVASAADAQEVCAAIRKELASL--ASP--RIADTVRVLYGGSVNAKNVGDIVAQDDVDGGLVGGASLDGEHFATLAAIAAGGPLP
2 PsiBlast_PDB 98.36100%-127 - C7 -3TAO TPIS_MYCTU A:[2-257] -SRKPLIAGNWKMNLNHYEAIALVQKI-AFSLPDKYYD--RVDVAVIPPFTDLRSVQTLV-DGDKLRLTYGAQDLSPHDSGAYTGDVSGAFLAKLGCSYVVVGHSERRTYHNEDDALVAAKAATALKHGLTPIVCIGEHLDVREAGNHVAHNI--EQLRGSLAGLLAE--QIGSVVIAYEPVWAIGTGRVASAADAQEVCAAIRKELASL--ASP--RIADTVRVLYGGSVNAKNVGDIVAQDDVDGGLVGGASLDGEHFATLAAIAAG----
21 PsiBlast_CBE 98.27100%-129 - C7 -3TAO TPIS_MYCTU B:[2-259] -SRKPLIAGNWKMNLNHYEAIALVQKI-AFSLPDKYYD--RVDVAVIPPFTDLRSVQTLV-DGDKLRLTYGAQDLSPHDSGAYTGDVSGAFLAKLGCSYVVVGHSERRTYHNEDDALVAAKAATALKHGLTPIVCIGEHLDVREAGNHVAHNI--EQLRGSLAGLLAE--QIGSVVIAYEPVWAIGTGRVASAADAQEVCAAIRKELASL--ASP--RIADTVRVLYGGSVNAKNVGDIVAQDDVDGGLVGGASLDGEHFATLAAIAAGGP--
3 PsiBlast_PDB 97.8599%-128 - C7 -3GVG TPIS_MYCTU A:[24-279] -SRKPLIAGNWKMNLNHYEAIALVQKI-AFSLPDKYYD--RVDVAVIPPFTDLRSVQTLV-DGDKLRLTYGAQDLSPHDSGAYTGDVSGAFLAKLGCSYVVVGHSERRTYHNEDDALVAAKAATALKHGLTPIVCIGEHLDVREAGNHVAHNI--EQLRGSLAGLLAE--QIGSVVIAYEPVWAIGTGRVASAADAQEVCAAIRKELASL--ASP--RIADTVRVLYGGSVNAKNVGDIVAQDDVDGGLVGGASLDGEHFATLAAIAAG----
22 PsiBlast_CBE 97.73100%-129 - C7 -3TA6 TPIS_MYCTU B:[2-257] -SRKPLIAGNWKMNLNHYEAIALVQKI-AFSLPDKYYD--RVDVAVIPPFTDLRSVQTLV-DGDKLRLTYGAQDLSPHDSGAYTGDVSGAFLAKLGCSYVVVGHSERRTYHNEDDALVAAKAATALKHGLTPIVCIGEHLDVREAGNHVAHNI--EQLRGSLAGLLAE--QIGSVVIAYEPVWAIGTGRVASAADAQEVCAAIRKELASL--ASP--RIADTVRVLYGGSVNAKNVGDIVAQDDVDGGLVGGASLDGEHFATLAAIAAG----
111 HHSearch 97.11100%-128 - C7 -3TA6 TPIS_MYCTU A:[3-257] --RKPLIAGNWKMNLNHYEAIALVQKI-AFSLPDKYYD--RVDVAVIPPFTDLRSVQTLV-DGDKLRLTYGAQDLSPHDSGAYTGDVSGAFLAKLGCSYVVVGHSERRTYHNEDDALVAAKAATALKHGLTPIVCIGEHLDVREAGNHVAHNI--EQLRGSLAGLLAE--QIGSVVIAYEPVWAIGTGRVASAADAQEVCAAIRKELASL--ASP--RIADTVRVLYGGSVNAKNVGDIVAQDDVDGGLVGGASLDGEHFATLAAIAAG----
1 PsiBlast_PDB 97.09100%-128 - C7 -3TA6 TPIS_MYCTU A:[3-257] --RKPLIAGNWKMNLNHYEAIALVQKI-AFSLPDKYYD--RVDVAVIPPFTDLRSVQTLV-DGDKLRLTYGAQDLSPHDSGAYTGDVSGAFLAKLGCSYVVVGHSERRTYHNEDDALVAAKAATALKHGLTPIVCIGEHLDVREAGNHVAHNI--EQLRGSLAGLLAE--QIGSVVIAYEPVWAIGTGRVASAADAQEVCAAIRKELASL--ASP--RIADTVRVLYGGSVNAKNVGDIVAQDDVDGGLVGGASLDGEHFATLAAIAAG----
23 PsiBlast_CBE 97.0899%-128 - C7 -3GVG TPIS_MYCTU B:[24-279] -SRKPLIAGNWKMNLNHYEAIALVQKI-AFSLPDKYYD--RVDVAVIPPFTDLRSVQTLV-DGDKLRLTYGAQDLSPHDSGAYTGDVSGAFLAKLGCSYVVVGHSERRTYHNEDDALVAAKAATALKHGLTPIVCIGEHLDVREAGNHVAHNI--EQLRGSLAGLLAE--QIGSVVIAYEPVWAIGTGRVASAADAQEVCAAIRKELASL--ASP--RIADTVRVLYGGSVNAKNVGDIVAQDDVDGGLVGGASLDGEHFATLAAIAAG----
120 HHSearch 83.1066%-121 - C7 -4Y9A - TPIS_STRCO A:[7-260] --RTPLMAGNWKMNLNHLEAIAHVQKL-AFALADKDYD--AVEVAVLAPFTDLRSVQTLV-DGDKLKIKYGAQDISAHDGGAYTGEISGPMLAKLKCTYVAVGHSERRQYHAETDEIVNAKVKAAYKHGLTPILCVGEELDVREAGNHVEHTL--AQVEGGLKDLAAE--QAESVVIAYEPVWAIGTGKVCGADDAQEVCAAIRGKLAEL--YSQ--ELADKVRIQYGGSVKSGNVAEIMAKPDIDGALVGGASLDSDEFVKIVRFRD-----
4 PsiBlast_PDB 81.5767%-119 - C7 -4Y9A - TPIS_STRCO A:[7-255] --RTPLMAGNWKMNLNHLEAIAHVQKL-AFALADKDYD--AVEVAVLAPFTDLRSVQTLV-DGDKLKIKYGAQDISAHDGGAYTGEISGPMLAKLKCTYVAVGHSERRQYHAETDEIVNAKVKAAYKHGLTPILCVGEELDVREAGNHVEHTL--AQVEGGLKDLAAE--QAESVVIAYEPVWAIGTGKVCGADDAQEVCAAIRGKLAEL--YSQ--ELADKVRIQYGGSVKSGNVAEIMAKPDIDGALVGGASLDSDEFVKI----------
7 PsiBlast_PDB 80.7844%-117 - C7 -1B9B PGKT_THEMA A:[2-252] -TRKLILAGNWKMHKTISEAKKFVSLL-VNELHD--VK--EFEIVVCPPFTALSEVGEIL-SGRNIKL--GAQNVFYEDQGAFTGEISPLMLQEIGVEYVIVGHSERRRIFKEDDEFINRKVKAVLEKGMTPILCVGETLEEREKGLTFCVVE--KQVREGFYGLDKE--EAKRVVIAYEPVWAIGTGRVATPQQAQEVHAFIRKLLSEM--YDE--ETAGSIRILYGGSIKPDNFLGLIVQKDIDGGLVGGASLK-ESFIELARIMRG----
119 HHSearch 80.1744%-122 * C7 *1B9B PGKT_THEMA A:[2-251] -TRKLILAGNWKMHKTISEAKKFVSLL-VNELH--DVK--EFEIVVCPPFTALSEVGEIL-S--GRNIKLGAQNVFYEDQGAFTGEISPLMLQEIGVEYVIVGHSERRRIFKEDDEFINRKVKAVLEKGMTPILCVGETLEEREKGLTFCVVE--KQVREGFYGLDKE--EAKRVVIAYEPVWAIGTGRVATPQQAQEVHAFIRKLLSEM--YDE--ETAGSIRILYGGSIKPDNFLGLIVQKDIDGGLVGGASLKE-SFIELARIMR-----
29 PsiBlast_CBE 79.5844%-119 - C7 -1B9B B:[1-252] ITRKLILAGNWKMHKTISEAKKFVSLL-VNELHD--VK--EFEIVVCPPFTALSEVGEIL-SGRNIKL--GAQNVFYEDQGAFTGEISPLMLQEIGVEYVIVGHSERRRIFKEDDEFINRKVKAVLEKGMTPILCVGETLEEREKGLTFCVVE--KQVREGFYGLDKE--EAKRVVIAYEPVWAIGTGRVATPQQAQEVHAFIRKLLSEM--YDE--ETAGSIRILYGGSIKPDNFLGLIVQKDIDGGLVGGASLK-ESFIELARIMRG----
101 Fugue 78.2744%-108 - C7 -2BTM TPIS_GEOSE A:[1-250] --RKPIIAGNWKMNGTLAEAVQFVEDV-KGHVPPA--D--EVISVVCAPFLFLDRLVQAA-D--GTDLKIGAQTMHFADQGAYTGEVSPVMLKDLGVTYVILGHSERRQMFAETDETVNKKVLAAFTRGLIPIICCGESLEEREAGQTNAVVA--SQVEKALAGLTPE--QVKQAVIAYEPIWAIGTGKSSTPEDANSVCGHIRSVVSRL--FGP--EAAEAIRIQYGGSVKPDNIRDFLAQQQIDGALVGGASLEPASFLQLVEAGR-----
116 HHSearch 77.7045%-112 - C7 -2BTM TPIS_GEOSE A:[1-250] --RKPIIAGNWKMNGTLAEAVQFVEDV-KGHVP--PAD--EVISVVCAPFLFLDRLVQAA-D--GTDLKIGAQTMHFADQGAYTGEVSPVMLKDLGVTYVILGHSERRQMFAETDETVNKKVLAAFTRGLIPIICCGESLEEREAGQTNAVVA--SQVEKALAGLTPE--QVKQAVIAYEPIWAIGTGKSSTPEDANSVCGHIRSVVSRL--FGP--EAAEAIRIQYGGSVKPDNIRDFLAQQQIDGALVGGASLEPASFLQLVEAGR-----
14 PsiBlast_PDB 76.7345%-102 - C7 -2BTM TPIS_GEOSE A:[1-245] --RKPIIAGNWKMNGTLAEAVQFVEDV-KGHVPPA--D--EVISVVCAPFLFLDRLVQAA-DGTDLKI--GAQTMHFADQGAYTGEVSPVMLKDLGVTYVILGHSERRQMFAETDETVNKKVLAAFTRGLIPIICCGESLEEREAGQTNAVVA--SQVEKALAGLTPE--QVKQAVIAYEPIWAIGTGKSSTPEDANSVCGHIRSVVSRL--FGP--EAAEAIRIQYGGSVKPDNIRDFLAQQQIDGALVGGASLEPASFLQL----------
24 PsiBlast_CBE 76.6349%-108 - C7 -1YYA TPIS_THET8 B:[2-249] --RRVLVAGNWKMHKTPSEARVWFAEL-KRLLPPL-----QSEAAVLPAFPILPVAKEVL-A--ETQVGYGAQDVSAHKEGAYTGEVSARMLSDLGCRYAIVGHSERRRYHGETDALVAEKAKRLLEEGITPILCVGEPLEVREKGEAVPYTL--RQLRGSLEGVEPP--GPEALVIAYEPVWAIGTGKNATPEDAEAMHQAIRKALSER--YGE--AFASRVRILYGGSVNPKNFADLLSMPNVDGGLVGGASLELESFLALLRIA------
114 HHSearch 76.6050%-108 - C7 -1YYA TPIS_THET8 A:[1-249] -MRRVLVAGNWKMHKTPSEARVWFAEL-KRLLP---PL--QSEAAVLPAFPILPVAKEVL-A--ETQVGYGAQDVSAHKEGAYTGEVSARMLSDLGCRYAIVGHSERRRYHGETDALVAEKAKRLLEEGITPILCVGEPLEVREKGEAVPYTL--RQLRGSLEGVEPP--GPEALVIAYEPVWAIGTGKNATPEDAEAMHQAIRKALSER--YGE--AFASRVRILYGGSVNPKNFADLLSMPNVDGGLVGGASLELESFLALLRIA------
36 PsiBlast_CBE 76.4945%-106 - C7 -4Y96 ? B:[6-255] -TRKKFVAGNWKMNTTLAEAKALGAAV-AKGVTD---D--RVTVAVFPPYPWLTAVGEVL-KGSPVAL--GAQDVSSEKKGAFTGEVSPAMLLETGCKYALIGHSERRHIIGESETFINHKVHTALEEGLSVVLCMGETLAERERGLQERVFQ--RQVYAACAGLTDE--QFGRIVIAYEPVWAIGTGKVATPEQAQEAHAFVRSKLRLL--YGD--KIADSTPIVYGGSVTPDNTVGLMSQPDVDGALVGGASLKADSF--LAIVKAAG---
18 PsiBlast_PDB 76.4942%-113 - C7 -4Y8F TPIS_CLOPE A:[5-248] --RTPIIAGNWKMHYTIDEAVKLVEEL-KPLVKDA-----KCEVVVCPTFVCLDAVKKAV-EGTNIKV--GAQNMHFEEKGAFTGEIAPRMLEAMNIDYVIIGHSERREYFNETDETCNKKVKAAFAHNLTPILCCGETLEQRENGTTNDVIK--AQITADLEGLTKE--QAEKVVIAYEPIWAIGTGKTATSDQANETIAAIRAMVAEM--FGQ--EVADKVRIQYGGSVKPNTIAEQMAKSDIDGALVGGASLVAADFAQI----------
5 PsiBlast_PDB 76.3749%-107 - C7 -1YYA TPIS_THET8 A:[2-249] --RRVLVAGNWKMHKTPSEARVWFAEL-KRLLPPL-----QSEAAVLPAFPILPVAKEVL-A--ETQVGYGAQDVSAHKEGAYTGEVSARMLSDLGCRYAIVGHSERRRYHGETDALVAEKAKRLLEEGITPILCVGEPLEVREKGEAVPYTL--RQLRGSLEGVEPP--GPEALVIAYEPVWAIGTGKNATPEDAEAMHQAIRKALSER--YGE--AFASRVRILYGGSVNPKNFADLLSMPNVDGGLVGGASLELESFLALLRIA------
37 PsiBlast_CBE 75.2444%-102 - C7 -1BTM TPIS_GEOSE B:[1-245] --RKPIIAGNWKMHKTLAEAVQFVEDV-KGHVPPA--D--EVISVVCAPFLFLDRLVQAA-DGTDLKI--GAQTMHFADQGAYTGEVSPVMLKDLGVTYVILGHSERRQMFAETDETVNKKVLAAFTRGLIPIICCGESLEEREAGQTNAVVA--SQVEKALAGLTPE--QVKQAVIAYEPIWAIGTGKSSTPEDANSVCGHIRSVVSRL--FGP--EAAEAIRIQYGGSVKPDNIRDFLAQQQIDGPLVGGASLEPASFLQL----------
35 PsiBlast_CBE 75.1545%-102 - C7 -2BTM TPIS_GEOSE B:[1-245] --RKPIIAGNWKMNGTLAEAVQFVEDV-KGHVPPA--D--EVISVVCAPFLFLDRLVQAA-DGTDLKI--GAQTMHFADQGAYTGEVSPVMLKDLGVTYVILGHSERRQMFAETDETVNKKVLAAFTRGLIPIICCGESLEEREAGQTNAVVA--SQVEKALAGLTPE--QVKQAVIAYEPIWAIGTGKSSTPEDANSVCGHIRSVVSRL--FGP--EAAEAIRIQYGGSVKPDNIRDFLAQQQIDGALVGGASLEPASFLQL----------
16 PsiBlast_PDB 74.9044%-101 - C7 -1BTM TPIS_GEOSE A:[1-245] --RKPIIAGNWKMHKTLAEAVQFVEDV-KGHVPPA--D--EVISVVCAPFLFLDRLVQAA-DGTDLKI--GAQTMHFADQGAYTGEVSPVMLKDLGVTYVILGHSERRQMFAETDETVNKKVLAAFTRGLIPIICCGESLEEREAGQTNAVVA--SQVEKALAGLTPE--QVKQAVIAYEPIWAIGTGKSSTPEDANSVCGHIRSVVSRL--FGP--EAAEAIRIQYGGSVKPDNIRDFLAQQQIDGPLVGGASLEPASFLQL----------
9 PsiBlast_PDB 74.5544%-105 - C7 -3UWU TPIS_STAAR A:[10-256] --RTPIIAGNWKMNKTVQEAKDFVNAL-P-TLPDS--K--EVESVICAPAIQLDALTTAVKEGKAQGLEIGAQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFKHGMTPIICVGETDEERESGK--ANDVVGEQVKKAVAGLSED--QLKSVVIAYEPIWAIGTGKSSTSEDANEMCAFVRQTIADL--SSK--EVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASLKVEDFVQL----------
11 PsiBlast_PDB 74.2744%-106 - C7 -3UWW TPIS_STAAR A:[10-256] --RTPIIAGNWKMNKTVQEAKDFVNAL-P-TLPDS--K--EVESVICAPAIQLDALTTAVKEGKAQGLEIGAQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFKHGMTPIICVGETDEERESGK--ANDVVGEQVKKAVAGLSED--QLKSVVIAYEPIWAIGTGKSSTSEDANEMCAFVRQTIADL--SSK--EVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASLKVEDFVQL----------
30 PsiBlast_CBE 74.0544%-106 - C7 -3M9Y TPIS_STAAR B:[3-249] --RTPIIAGNWKMNKTVQEAKDFVNAL-P-TLPDS--K--EVESVICAPAIQLDALTTAVKEGKAQGLEIGAQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFKHGMTPIICVGETDEERESGK--ANDVVGEQVKKAVAGLSED--QLKSVVIAYEPIWAIGTGKSSTSEDANEMCAFVRQTIADL--SSK--EVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASLKVEDFVQL----------
13 PsiBlast_PDB 73.9844%-104 - C7 -3UWZ TPIS_STAAR A:[10-256] --RTPIIAGNWKMNKTVQEAKDFVNAL-P-TLPDS--K--EVESVICAPAIQLDALTTAVKEGKAQGLEIGAQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFKHGMTPIICVGETDEERESGK--ANDVVGEQVKKAVAGLSED--QLKSVVIAYEPIWAIGTGKSSTSEDANEMCAFVRQTIADL--SSK--EVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASLKVEDFVQL----------
10 PsiBlast_PDB 73.9144%-105 - C7 -3UWV TPIS_STAAR A:[10-256] --RTPIIAGNWKMNKTVQEAKDFVNAL-P-TLPDS--K--EVESVICAPAIQLDALTTAVKEGKAQGLEIGAQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFKHGMTPIICVGETDEERESGK--ANDVVGEQVKKAVAGLSED--QLKSVVIAYEPIWAIGTGKSSTSEDANEMCAFVRQTIADL--SSK--EVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASLKVEDFVQL----------
77 PsiBlast_CBE 73.6541%-109 - C7 -4MKN ? A:[18-266] -SAKFFVGGNWKCNGSVANVAKLVDELNAGTIPRG------VDVVVAPPFIYIDYVMQHL-DRDKYQLS--AQNAWIGGNGAFTGEVSAEQLTDFGVPWVILGHSERRSLFGESNEVVAKKTSHALAAGLGVIACIGETLEQRNSGSV----F--KVLDAQMDALVDEVKDWTKVVLAYEPVWAIGTGVVASPEQAQEVHAYLRQYCAKK--LGA--AVADKLRIIYGGSVSDTNCKDLSKQEDIDGFLVGGASLKGAAFVTIC--NAAGP--
34 PsiBlast_CBE 73.5544%-103 - C7 -3UWU TPIS_STAAR B:[10-256] --RTPIIAGNWKMNKTVQEAKDFVNAL-P-TLPDS--K--EVESVICAPAIQLDALTTAVKEGKAQGLEIGAQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFKHGMTPIICVGETDEERESGK--ANDVVGEQVKKAVAGLSED--QLKSVVIAYEPIWAIGTGKSSTSEDANEMCAFVRQTIADL--SSK--EVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASLKVEDFVQL----------
32 PsiBlast_CBE 72.9544%-102 - C7 -3UWW TPIS_STAAR B:[10-256] --RTPIIAGNWKMNKTVQEAKDFVNAL-P-TLPDS--K--EVESVICAPAIQLDALTTAVKEGKAQGLEIGAQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFKHGMTPIICVGETDEERESGK--ANDVVGEQVKKAVAGLSED--QLKSVVIAYEPIWAIGTGKSSTSEDANEMCAFVRQTIADL--SSK--EVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASLKVEDFVQL----------
33 PsiBlast_CBE 72.8844%-105 - C7 -3UWV TPIS_STAAR B:[10-256] --RTPIIAGNWKMNKTVQEAKDFVNAL-P-TLPDS--K--EVESVICAPAIQLDALTTAVKEGKAQGLEIGAQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFKHGMTPIICVGETDEERESGK--ANDVVGEQVKKAVAGLSED--QLKSVVIAYEPIWAIGTGKSSTSEDANEMCAFVRQTIADL--SSK--EVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASLKVEDFVQL----------
97 PsiBlast_CBE 72.0340%-101 - C7 -7TIM TPIS_YEAST B:[1-239] -ARTFFVGGNFKLNGSKQSIKEIVERLNTASIPE------NVEVVICPPATYLDYSVSLV-K--KPQVTVGAQNAYLKASGAFTGENSVDQIKDVGAKWVILGHSERRSYFHEDDKFIADKTKFALGQGVGVILCIGETLEEKKAGKTLDVVE--RQLNAVLEEV--K--DWTNVVVAYEPVWAIGTGLAATPEDAQDIHASIRKFLASK--LGD--KAASELRILYGGSANGSNAVTFKDKADVDGFLVGGASLKPEF--------------
31 PsiBlast_CBE 71.9944%-105 - C7 -3UWZ TPIS_STAAR B:[10-256] --RTPIIAGNWKMNKTVQEAKDFVNAL-P-TLPDS--K--EVESVICAPAIQLDALTTAVKEGKAQGLEIGAQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFKHGMTPIICVGETDEERESGK--ANDVVGEQVKKAVAGLSED--QLKSVVIAYEPIWAI---KSSTSEDANEMCAFVRQTIADL--SSK--EVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASLKVEDFVQL----------
72 PsiBlast_CBE 71.3039%-100 - C7 -4YMZ ? B:[2-250] -ARKTIIAGNWKMNLSLKEAVFLAHSI-REKIPSISKD--KVSM-VFPSTLHLENVSKIL-EGSSV--IVGAQNCYHSGLAAFTGETSPDQLKEIGVKVVMVGHSERRQFLGESNFFCNDKIRFLLKNEFTVLYCVGETLSERESGKTLEVLS--SQIREGLKGIDSV--FFSNLILAYEPVWAIGTGKVATPSQAQEVHSFIRKEISGLFVGAS--SISESISILYGGSVKPDNIQDLLKEKDIDGGLVGGASQKISSFAGL----------
129 HHSearch 71.1439%-111 - C7 -4YMZ ? A:[2-251] -ARKTIIAGNWKMNLSLKEAVFLAHSI-REKIP-SISK--DKVSMVFPSTLHLENVSKIL-E--GSSVIVGAQNCYHSGLAAFTGETSPDQLKEIGVKVVMVGHSERRQFLGESNFFCNDKIRFLLKNEFTVLYCVGETLSERESGKTLEVLS--SQIREGLKGIDSV--FFSNLILAYEPVWAIGTGKVATPSQAQEVHSFIRKEISGL--FVGASSISESISILYGGSVKPDNIQDLLKEKDIDGGLVGGASQKISSFAGLF---------
112 HHSearch 71.0041%-115 - C7 -4MVA ? A:[25-276] -MRHPLVMGNWKLNGSRHMVHELVSNL-RKELA--GVA--GCAVAIAPPEMYIDMAKREA-E--GSHIMLGAQNVDLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQGLTPVLCIGETEAENEAGKTEEVCA--RQIDAVLKTQGAA--AFEGAVIAYEPVWAIGTGKSATPAQAQAVHKFIRDHIAKV---DA--NIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKADAFAVIVKAAEAA---
102 Fugue 70.8140% -95 - C7 -1IF2 TPIS_LEIME A:[3-251] AKPQPIAAANWKCNGTTASIEKLVQVF-NEHTISH-----DVQCVVAPTFVHIPLVQAKL-RNPKYVI--SAQNAIA-KSGAFTGEVSMPILKDIGVHWVILGHSERRTYYGETDEIVAQKVSEACKQGFMVIACIGETLQQREANQTAKVVL--SQTSAIAAKLTKD--AWNQVVLAYEPVWAIGTGKVATPEQAQEVHLLLRKWVSEN--IGT--DVAAKLRILYGGSVNAANAATLYAKPDINGFLVGGASLKPEFRDIIDATR------
73 PsiBlast_CBE 70.7239%-101 - C7 -4YMZ ? A:[2-250] -ARKT