@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Rv1869c: (2016-05-05 )
MASSTTFVIVGGGLAGAKAVEALRRSDFGGRIILFGDEEHLPYDRPPLSKEFLAGKKSLSDFTIQTSDWYRDHDVDVRLGVRVSSLDRSAHTVELPDGAAVRYDKLLLATGSAPRRPPIPGSDAAGVHYLRSYNDAVALNSVLVQGSSLAVVGAGWIGLEVAASARQRGVDVTVVETAIQPLLAALGEAVGKVFADLHRDQGVDLRLQTQLEEITAADGKATGLKMRDGSTVAADAVLVAVGAKPNVELAQQAGLAMGEGGVLVDASLRTSDPDIYAVGDIAAAEHPLLGTRVRTEHWANALKQPAVAAAGMLGRPGEYAELPYLFTDQYDLGMEYVGHAPSCDRVVFRGNVAGREFLSFWLDGDSRVLAGMNVNVWDVVDDVKGLIRSGNPVDVDRLVDPQWPLADLTTN

Atome Classification :

(38 SA) .........10........20........30........40........50........60........70........80........90........100.......110.....-..120--..---......130.......140.......150.......160.......170.......180.......190.......200.......---------210--......--.220.......230.......240.......250.......260.......270.......280......-.290.......300.......310....-..--.320.......330.......340.......350---.--......360.......370.......380.......390.......400.......410
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MASSTTFVIVGGGLAGAKAVEALRRSDFGGRIILFGDEEHLPYDRPPLSKEFLAGKKSLSDFTIQTSDWYRDHDVDVRLGVRVSSLDRSAHTVELPDGAAVRYDKLLLATGSAPRRP-PIPG---SD---AAGVHYLRSYNDAVALNSVLVQGSSLAVVGAGWIGLEVAASARQRGVDVTVVETAIQPLLAALGEAVGKVFADLHRDQGVDLRLQT---------QLE--EITAAD--GKATGLKMRDGSTVAADAVLVAVGAKPNVELAQQAGLAMGEGGVLVDASLRTSDPDIYAVGDIAAAEHPL-LGTRVRTEHWANALKQPAVAAAGMLGRP-GE--YAELPYLFTDQYDLGMEYVGHAPSCDRVVFRGNV---A--GREFLSFWLDGDSRVLAGMNVNVWDVVDDVKGLIRSGNPVDVDRLVDPQWPLADLTTN
2 PsiBlast_PDB 96.1336%-110 - C1 -1Q1R CAMA_PSEPU A:[2-411] -NANDNVVIVGTGLAGVEVAFGLRASGWEGNIRLVGDATVIPHHLPPLSKAYLAGKATAESLYLRTPDAYAAQNIQLLGGTQVTAINRDRQQVILSDGRALDYDRLVLATGGRPRPL-PVASGAVGK---ANNFRYLRTLEDAECIRRQLIADNRLVVIGGGYIGLEVAATAIKANMHVTLLDTAARVLERVTAPPVSAFYEHLHREAGVDIRTGT---------QVCGFEMSTDQ--QKVTAVLCEDGTRLPADLVIAGIGLIPNCELASAAGLQV-DNGIVINEHMQTSDPLIMAVGDCARFHSQL-YDRWVRIESVPNALEQARKIAAILCGKV-PR--DEAAPWFWSDQYEIGLKMVGLSEGYDRIIVRGSL---A--QPDFSVFYLQGD-RVLAVDTVNRPVEFNQSKQIITDRLPVEPNLLGDESVPLKEI---
22 PsiBlast_CBE 96.0636%-109 - C1 -1Q1R CAMA_PSEPU B:[2-411] -NANDNVVIVGTGLAGVEVAFGLRASGWEGNIRLVGDATVIPHHLPPLSKAYLAGKATAESLYLRTPDAYAAQNIQLLGGTQVTAINRDRQQVILSDGRALDYDRLVLATGGRPRPL-PVASGAVGK---ANNFRYLRTLEDAECIRRQLIADNRLVVIGGGYIGLEVAATAIKANMHVTLLDTAARVLERVTAPPVSAFYEHLHREAGVDIRTGT---------QVCGFEMSTDQ--QKVTAVLCEDGTRLPADLVIAGIGLIPNCELASAAGLQV-DNGIVINEHMQTSDPLIMAVGDCARFHSQL-YDRWVRIESVPNALEQARKIAAILCGKV-PR--DEAAPWFWSDQYEIGLKMVGLSEGYDRIIVRGSL---A--QPDFSVFYLQGD-RVLAVDTVNRPVEFNQSKQIITDRLPVEPNLLGDESVPLKEI---
4 PsiBlast_PDB 96.0036%-111 - C1 -3LB8 CAMA_PSEPU A:[2-410] --ANDNVVIVGTGLAGVEVAFGLRASGWEGNIRLVGDATVIPHHLPPLSKAYLAGKATAESLYLRTPDAYAAQNIQLLGGTQVTAINRDRQQVILSDGRALDYDRLVLATGGRPRPL-PVASGAVGK---ANNFRYLRTLEDAECIRRQLIADNRLVVIGGGYIGLEVAATAIKANMHVTLLDTAARVLERVTAPPVSAFYEHLHREAGVDIRTGT---------QVCGFEMSTDQ--QKVTAVLCEDGTRLPADLVIAGIGLIPNCELASAAGLQV-DNGIVINEHMQTSDPLIMAVGDCARFHSQL-YDRWVRIESVPNALEQARKIAAILCGKV-PR--DEAAPWFWSDQYEIGLKMVGLSEGYDRIIVRGSL---A--QPDFSVFYLQGD-RVLAVDTVNRPVEFNQSKQIITDRLPVEPNLLGDESVPLKEI---
21 PsiBlast_CBE 94.7636%-110 - C1 -1Q1W CAMA_PSEPU B:[3-411] --ANDNVVIVGTGLAGVEVAFGLRASGWEGNIRLVGDATVIPHHLPPLSKAYLAGKATAESLYLRTPDAYAAQNIQLLGGTQVTAINRDRQQVILSDGRALDYDRLVLATGGRPRPL-PVASGAVGK---ANNFRYLRTLEDAECIRRQLIADNRLVVIGGGYIGLEVAATAIKANMHVTLLDTAARVLERVTAPPVSAFYEHLHREAGVDIRTGT---------QVCGFEMSTDQ--QKVTAVLCEDGTRLPADLVIAGIGLIPNCELASAAGLQV-DNGIVINEHMQTSDPLIMAVGDCARFHSQL-YDRWVRIESVPNALEQARKIAAILCGKV-PR--DEAAPWFWSDQYEIGLKMVGLSEGYDRIIVRGSL---A--QPDFSVFYLQGD-RVLAVDTVNRPVEFNQSKQIITDRLPVEPNLLGDESVPLKEI---
3 PsiBlast_PDB 94.0936%-109 - C1 -1Q1W CAMA_PSEPU A:[2-411] -NANDNVVIVGTGLAGVEVAFGLRASGWEGNIRLVGDATVIPHHLPPLSKAYLAGKATAESLYLRTPDAYAAQNIQLLGGTQVTAINRDRQQVILSDGRALDYDRLVLATGGRPRPL-PVASGAVGK---ANNFRYLRTLEDAECIRRQLIADNRLVVIGGGYIGLEVAATAIKANMHVTLLDTAARVLERVTAPPVSAFYEHLHREAGVDIRTGT---------QVCGFEMSTDQ--QKVTAVLCEDGTRLPADLVIAGIGLIPNCELASAAGLQV-DNGIVINEHMQTSDPLIMAVGDCARFHSQL-YDRWVRIESVPNALEQARKIAAILCGKV-PR--DEAAPWFWSDQYEIGLKMVGLSEGYDRIIVRGSL---A--QPDFSVFYLQGD-RVLAVDTVNRPVEFNQSKQIITDRLPVEPNLLGDESVPLKEI---
17 PsiBlast_PDB 93.1138%-107 - C1 -4H4P ? A:[11-402] -------VVLGAGLASVSFVAELRQAGYQGLITVVGDEAERPYDRPPLSKDFMAH----GDAEKIRLDCKRAPEVEWLLGVTAQSFDPQAHTVALSDGRTLPYGTLVLATGAAPRAL-PTLQ---GA---TMPVHTLRTLEDARRIQAGLRPQSRLLIVGGGVIGLELAATARTAGVHVSLVQTKPRLMSRAAPATLADFVARYHAAQGVDLRFER---------SV----TGSVD--GV---VLLDDGTRIAADMVVVGIGVLANDALARAAGLAC-DDGIFVDAYGRTTCPDVYALGDVTRQRNPL-SGRFERIETWSNAQNQ-GIAVARHLVDP-TAPGYAELPWYWSDQGALRIQVAGLA-SGDEEIVRGEV---SLDAPKFTLIELQ-KGRIVGATCVNNARDFAPLRRLLAVGAKPDRAALADPATDLRKL---
13 PsiBlast_PDB 93.0838%-106 - C1 -2YVF ? A:[11-402] -------VVLGAGLASVSFVAELRQAGYQGLITVVGDEAERPYDRPPLSKDFMAH----GDAEKIRLDCKRAPEVEWLLGVTAQSFDPQAHTVALSDGRTLPYGTLVLATGAAPRAL-PTLQ---GA---TMPVHTLRTLEDARRIQAGLRPQSRLLIVGGGVIGLELAATARTAGVHVSLVETQPRLMSRAAPATLADFVARYHAAQGVDLRFER---------SV----TGSVD--GV---VLLDDGTRIAADMVVVGIGVLANDALARAAGLAC-DDGIFVDAYGRTTCPDVYALGDVTRQRNPL-SGRFERIETWSNAQNQ-GIAVARHLVDP-TAPGYAELPWYWSDQGALRIQVAGLA-SGDEEIVRGEV---SLDAPKFTLIELQ-KGRIVGATCVNNARDFAPLRRLLAVGAKPDRAALADPATDLRKL---
10 PsiBlast_PDB 92.9838%-108 - C1 -2GR0 ? A:[11-402] -------VVLGAGLASVSFVAELRQAGYQGLITVVGDEAERPYDRPPLSKDFMAH----GDAEKIRLDCKRAPEVEWLLGVTAQSFDPQAHTVALSDGRTLPYGTLVLATGAAPRAL-PTLQ---GA---TMPVHTLRTLEDARRIQAGLRPQSRLLIVGGGVIGLELAATARTAGVHVSLVETQPRLMSRAAPATLADFVARYHAAQGVDLRFER---------SV----TGSVD--GV---VLLDDGTRIAADMVVVGIGVLANDALARAAGLAC-DDGIFVDAYGRTTCPDVYALGDVTRQRNPL-SGRFERIETWSNAQNQ-GIAVARHLVDP-TAPGYAELPWYWSDQGALRIQVAGLA-SGDEEIVRGEV---SLDAPKFTLIELQ-KGRIVGATCVNNARDFAPLRRLLAVGAKPDRAALADPATDLRKL---
16 PsiBlast_PDB 92.9538%-106 - C1 -4H4Q ? A:[11-402] -------VVLGAGLASVSFVAELRQAGYQGLITVVGDEAERPYDRPPLSKDFMAH----GDAEKIRLDCKRAPEVEWLLGVTAQSFDPQAHTVALSDGRTLPYGTLVLATGAAPRAL-PTLQ---GA---TMPVHTLRTLEDARRIQAGLRPQSRLLIVGGGVIGLELAATARTAGVHVSLVQTKPRLMSRAAPATLADFVARYHAAQGVDLRFER---------SV----TGSVD--GV---VLLDDGTRIAADMVVVGIGVLANDALARAAGLAC-DDGIFVDAYGRTTCPDVYALGDVTRQRNPL-SGRFERIETWSNAQNQ-GIAVARHLVDP-TAPGYAELPWYWSDQGALRIQVAGLA-SGDEEIVRGEV---SLDAPKFTLIELQ-KGRIVGATCVNNARDFAPLRRLLAVGAKPDRAALADPATDLRKL---
14 PsiBlast_PDB 92.9038%-107 - C1 -2YVG ? A:[11-402] -------VVLGAGLASVSFVAELRQAGYQGLITVVGDEAERPYDRPPLSKDFMAH----GDAEKIRLDCKRAPEVEWLLGVTAQSFDPQAHTVALSDGRTLPYGTLVLATGAAPRAL-PTLQ---GA---TMPVHTLRTLEDARRIQAGLRPQSRLLIVGGGVIGLELAATARTAGVHVSLVETQPRLMSRAAPATLADFVARYHAAQGVDLRFER---------SV----TGSVD--GV---VLLDDGTRIAADMVVVGIGVLANDALARAAGLAC-DDGIFVDAYGRTTCPDVYALGDVTRQRNPL-SGRFERIETWSNAQNQ-GIAVARHLVDP-TAPGYAELPWYWSDQGALRIQVAGLA-SGDEEIVRGEV---SLDAPKFTLIELQ-KGRIVGATCVNNARDFAPLRRLLAVGAKPDRAALADPATDLRKL---
23 PsiBlast_CBE 92.8236%-110 - C1 -3LB8 CAMA_PSEPU B:[2-410] --ANDNVVIVGTGLAGVEVAFGLRASGWEGNIRLVGDATVIPHHLPPLSKAYLAGKATAESLYLRTPDAYAAQNIQLLGGTQVTAINRDRQQVILSDGRALDYDRLVLATGGRPRPL-PVASGAVGK---ANNFRYLRTLEDAECIRRQLIADNRLVVIGGGYIGLEVAATAIKANMHVTLLDTAARVLERVTAPPVSAFYEHLHREAGVDIRTGT---------QVCGFEMSTDQ--QKVTAVLCEDGTRLPADLVIAGIGLIPNCELASAAGLQV-DNGIVINEHMQTSDPLIMAVGDCARFHSQL-YDRWVRIESVPNALEQARKIAAILCGKV-PR--DEAAPWFWSDQYEIGLKMVGLSEGYDRIIVRGSL---A--QPDFSVFYLQGD-RVLAVDTVNRPVEFNQSKQIITDRLPVEPNLLGDESVPLKEI---
20 PsiBlast_PDB 92.7238%-108 - C1 -4H4S ? A:[11-402] -------VVLGAGLASVSFVAELRQAGYQGLITVVGDEAERPYDRPPLSKDFMAH----GDAEKIRLDCKRAPEVEWLLGVTAQSFDPQAHTVALSDGRTLPYGTLVLATGAAPRAL-PTLQ---GA---TMPVHTLRTLEDARRIQAGLRPQSRLLIVGGGVIGLELAATARTAGVHVSLVCTGPRLMSRAAPATLADFVARYHAAQGVDLRFER---------SV----TGSVD--GV---VLLDDGTRIAADMVVVGIGVLANDALARAAGLAC-DDGIFVDAYGRTTCPDVYALGDVTRQRNPL-SGRFERIETWSNAQNQ-GIAVARHLVDP-TAPGYAELPWYWSDQGALRIQVAGLA-SGDEEIVRGEV---SLDAPKFTLIELQ-KGRIVGATCVNNARDFAPLRRLLAVGAKPDRAALADPATDLRKL---
25 PsiBlast_CBE 92.4638%-107 - C1 -4H4R ? A:[11-402] -------VVLGAGLASVSFVAELRQAGYQGLITVVGDEAERPYDRPPLSKDFMAH----GDAEKIRLDCKRAPEVEWLLGVTAQSFDPQAHTVALSDGRTLPYGTLVLATGAAPRAL-PTLQ---GA---TMPVHTLRTLEDARRIQAGLRPQSRLLIVGGGVIGLELAATARTAGVHVSLVCTGPRLMSRAAPATLADFVARYHAAQGVDLRFER---------SV----TGSVD--GV---VLLDDGTRIAADMVVVGIGVLANDALARAAGLAC-DDGIFVDAYGRTTCPDVYALGDVTRQRNPL-SGRFERIETWSNAQNQ-GIAVARHLVDP-TAPGYAELPWYWSDQGALRIQVAGLA-SGDEEIVRGEV---SLDAPKFTLIELQ-KGRIVGATCVNNARDFAPLRRLLAVGAKPDRAALADPATDLRKL---
9 PsiBlast_PDB 92.4038%-106 - C1 -2GQW ? A:[11-402] -------VVLGAGLASVSFVAELRQAGYQGLITVVGDEAERPYDRPPLSKDFMAH----GDAEKIRLDCKRAPEVEWLLGVTAQSFDPQAHTVALSDGRTLPYGTLVLATGAAPRAL-PTLQ---GA---TMPVHTLRTLEDARRIQAGLRPQSRLLIVGGGVIGLELAATARTAGVHVSLVETQPRLMSRAAPATLADFVARYHAAQGVDLRFER---------SV----TGSVD--GV---VLLDDGTRIAADMVVVGIGVLANDALARAAGLAC-DDGIFVDAYGRTTCPDVYALGDVTRQRNPL-SGRFERIETWSNAQNQ-GIAVARHLVDP-TAPGYAELPWYWSDQGALRIQVAGLA-SGDEEIVRGEV---SLDAPKFTLIELQ-KGRIVGATCVNNARDFAPLRRLLAVGAKPDRAALADPATDLRKL---
27 PsiBlast_CBE 92.3137%-107 - C1 -4H4Z ? A:[11-402] -------VVLGAGLASVSFVAELRQAGYQGLITVVGDEAERPYDRPPLSKDFMAH----GDAEKIRLDCKRAPEVEWLLGVTAQSFDPQAHTVALSDGRTLPYGTLVLATGAAPRAL-PTLQ---GA---TMPVHTLRTLEDARRIQAGLRPQSRLLIVGGGVIGLELAATARTAGVHVSLVQRGPRLMSRAAPATLADFVARYHAAQGVDLRFER---------SV----TGSVD--GV---VLLDDGTRIAADMVVVGIGVLANDALARAAGLAC-DDGIFVDAYGRTTCPDVYALGDVTRQRNPL-SGRFERIETWSNAQNQ-GIAVARHLVDP-TAPGYAELPWYWSDQGALRIQVAGLA-SGDEEIVRGEV---SLDAPKFTLIELQ-KGRIVGATCVNNARDFAPLRRLLAVGAKPDRAALADPATDLRKL---
11 PsiBlast_PDB 91.8638%-106 - C1 -2GR1 ? A:[11-402] -------VVLGAGLASVSFVAELRQAGYQGLITVVGDEAERPYDRPPLSKDFMAH----GDAEKIRLDCKRAPEVEWLLGVTAQSFDPQAHTVALSDGRTLPYGTLVLATGAAPRAL-PTLQ---GA---TMPVHTLRTLEDARRIQAGLRPQSRLLIVGGGVIGLELAATARTAGVHVSLVETQPRLMSRAAPATLADFVARYHAAQGVDLRFER---------SV----TGSVD--GV---VLLDDGTRIAADMVVVGIGVLANDALARAAGLAC-DDGIFVDAYGRTTCPDVYALGDVTRQRNPL-SGRFERIETWSNAQNQ-GIAVARHLVDP-TAPGYAELPWYWSDQGALRIQVAGLA-SGDEEIVRGEV---SLDAPKFTLIELQ-KGRIVGATCVNNARDFAPLRRLLAVGAKPDRAALADPATDLRKL---
69 HHSearch 91.8136%-105 - C1 -1Q1R CAMA_PSEPU A:[2-412] -NANDNVVIVGTGLAGVEVAFGLRASGWEGNIRLVGDATVIPHHLPPLSKAYLAGKATAESLYLRTPDAYAAQNIQLLGGTQVTAINRDRQQVILSDGRALDYDRLVLATGGRPRPL-PVAS---GAVGKANNFRYLRTLEDAECIRRQLIADNRLVVIGGGYIGLEVAATAIKANMHVTLLDTAARVLERVTAPPVSAFYEHLHREAGVDIRTGT---------QVC--GFEMSTDQQKVTAVLCEDGTRLPADLVIAGIGLIPNCELASAAGLQVD-NGIVINEHMQTSDPLIMAVGDCARFHSQL-YDRWVRIESVPNALEQARKIAAILCGKV-PR--DEAAPWFWSDQYEIGLKMVGLSEGYDRI-IVRGSL--A--QPDFSVFY-LQGDRVLAVDTVNRPVEFNQSKQIITDRLPVEPNLLGDESVPLKEII--
28 PsiBlast_CBE 91.8037%-106 - C1 -4H4Y ? A:[11-402] -------VVLGAGLASVSFVAELRQAGYQGLITVVGDEAERPYDRPPLSKDFMAH----GDAEKIRLDCKRAPEVEWLLGVTAQSFDPQAHTVALSDGRTLPYGTLVLATGAAPRAL-PTLQ---GA---TMPVHTLRTLEDARRIQAGLRPQSRLLIVGGGVIGLELAATARTAGVHVSLVARGPRLMSRAAPATLADFVARYHAAQGVDLRFER---------SV----TGSVD--GV---VLLDDGTRIAADMVVVGIGVLANDALARAAGLAC-DDGIFVDAYGRTTCPDVYALGDVTRQRNPL-SGRFERIETWSNAQNQ-GIAVARHLVDP-TAPGYAELPWYWSDQGALRIQVAGLA-SGDEEIVRGEV---SLDAPKFTLIELQ-KGRIVGATCVNNARDFAPLRRLLAVGAKPDRAALADPATDLRKL---