@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Rv1872c: (2016-05-05 )
MAVNRRVPRVRDLAPLLQFNRPQFDTSKRRLGAALTIQDLRRIAKRRTPRAAFDYADGGAEDELSIARARQGFRDIEFHPTILRDVTTVCAGWNVLGQPTVLPFGIAPTGFTRLMHTEGEIAGARAAAAAGIPFSLSTLATCAIEDLVIAVPQGRKWFQLYMWRDRDRSMALVRRVAAAGFDTMLVTVDVPVAGARLRDVRNGMSIPPALTLRTVLDAMGHPRWWFDLLTTEPLAFASLDRWPGTVGEYLNTVFDPSLTFDDLAWIKSQWPGKLVVKGIQTLDDARAVVDRGVDGIVLSNHGGRQLDRAPVPFHLLPHVARELGKHTEILVDTGIMSGADIVAAIALGARCTLIGRAYLYGLMAGGEAGVNRAIEILQTGVIRTMRLLGVTCLEELSPRHVTQLRRLGPIGAPT

Atome Classification :

(38 SA) .........10........20........30........40........50........60........70........80........90........100.......110..---...-..120.......--130.......140.......150--....--...160.......170.......180.......190.......200---........210.......220.......230.......240......--..250.......260.......270.......280.......290.......300.......310.......-----320.-----......330.......340.......350.......360.......370.......380.......390.......400.......410..
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MAVNRRVPRVRDLAPLLQFNRPQFDTSKRRLGAALTIQDLRRIAKRRTPRAAFDYADGGAEDELSIARARQGFRDIEFHPTILRDVTTVCAGWNVLGQPTVLPFGIAPTGFTRL---MHT-EGEIAGARAAAA--AGIPFSLSTLATCAIEDLVIAVP--QGRK--WFQLYMWRDRDRSMALVRRVAAAGFDTMLVTVDVPVAGARLRDVR----NGMSIPPALTLRTVLDAMGHPRWWFDLLTTEPLAFASLDR-WPGTVG--EYLNTVFDPSLTFDDLAWIKSQWPGKLVVKGIQTLDDARAVVDRGVDGIVLSNHGGRQLDRAPVPFHLLPHV-----AREL-----GKHTEILVDTGIMSGADIVAAIALGARCTLIGRAYLYGLMAGGEAGVNRAIEILQTGVIRTMRLLGVTCLEELSPRHVTQLRRLGPIGAPT
54 HHSearch 95.8636%-107 - C5 -1GOX GOX_SPIOL A:[2-358] --------------------------------EITNVNEYEAIAKQKLPKMVYDYYASGAEDQWTLAENRNAFSRILFRPRILIDVTNIDMTTTILGFKISMPIMIAPTAMQKM---AHP-EGEYATARAASA--AGTIMTLSSWATSSVEEVASTG---PGIR--FFQLYVYKDRNVVAQLVRRAERAGFKAIALTVDTPRLGRREADIK----NRFVLPPFLTLKNFEGI----------------DLG---------LS--SYVAGQIDRSLSWKDVAWLQTITSLPILVKGVITAEDARLAVQHGAAGIIVSNHGARQLDYVPATIMALEEV-----VKAA-----QGRIPVFLDGGVRRGTDVFKALALGAAGVFIGRPVVFSLAAEGEAGVKKVLQMMRDEFELTMALSGCRSLKEISRSHIAADW---------
14 PsiBlast_PDB 94.8935%-110 - C5 -1GOX GOX_SPIOL A:[5-354] -----------------------------------NVNEYEAIAKQKLPKMVYDYYASGAEDQWTLAENRNAFSRILFRPRILIDVTNIDMTTTILGFKISMPIMIAPTAMQKM---AHP-EGEYATARAASA--AGTIMTLSSWATSSVEEVASTGP---GIR--FFQLYVYKDRNVVAQLVRRAERAGFKAIALTVDTPRLGRREADIK----NRFVLPPFLTLKNF----------------EGIDLG---------LS--SYVAGQIDRSLSWKDVAWLQTITSLPILVKGVITAEDARLAVQHGAAGIIVSNHGARQLDYVPATIMALEEV-----VKAA-----QGRIPVFLDGGVRRGTDVFKALALGAAGVFIGRPVVFSLAAEGEAGVKKVLQMMRDEFELTMALSGCRSLKEISRSHI-------------
52 HHSearch 94.8538%-107 - C5 -1P4C GOX_SPIOL A:[4-356] --------------------------------NLFNVEDYRKLAQKRLPKMVYDYLEGGAEDEYGVKHNRDVFQQWRFKPKRLVDVSRRSLQAEVLGKRQSMPLLIGPTGLNGA---LWP-KGDLALARAATK--AGIPFVLSTASNMSIEDLARQ-C--DGDL--WFQLYVIH-REIAQGMVLKALHTGYTTLVLTTDVAVNGYRERDLH----NRFKIPPFLTLKNFEGI----------------DLGKMDKANLEMQA--ALMSRQMDASFNWEALRWLRDLWPHKLLVKGLLSAEDADRCIAEGADGVILSNHGGRQLDCAISPMEVLAQS-----VAKT-------GKPVLIDSGFRRGSDIVKALALGAEAVLLGRATLYGLAARGETGVDEVLTLLKADIDRTLAQIGCPDITSLSPDYLQNE----------
5 PsiBlast_PDB 93.9436%-111 - C5 -2A7P GOX_SPIOL (first) A:[6-355] ----------------------------------FNVEDYRKLAQKRLPKMVYDYLEGGAEDEYGVKHNRDVFQQWRFKPKRLVDVSRRSLQAEVLGKRQSMPLLIGPTALNGA---LWP-KGDLALARAATK--AGIPFVLSTASNMSIEDLARQC---DGDL--WFQLYVIH-REIAQGMVLKALHTGYTTLVLTTDVAVNGYRERDLH----NRFKIPPFLTLKN-----------FEGIDLGKMDKANLEM-QAALMS--RQM----DASFNWEALRWLRDLWPHKLLVKGLLSAEDADRCIAEGADGVILSNHGGRQLDCAISPMEVLAQS-----VAKT-----GK--PVLIDSGFRRGSDIVKALALGAEAVLLGRATLYGLAARGETGVDEVLTLLKADIDRTLAQIGCPDITSLSPDYLQN-----------
7 PsiBlast_PDB 93.8036%-109 - C5 -3GIY MDLB_PSEPU A:[6-355] ----------------------------------FNVEDYRKLAQKRLPKMVYDYLEGGAEDEYGVKHNRDVFQQWRFKPKRLVDVSRRSLQAEVLGKRQSMPLLIGPTALNGA---LWP-KGDLALARAATK--AGIPFVLSTASNMSIEDLARQC---DGDL--WFQLYVIH-REIAQGMVLKALHTGYTTLVLTTDVAVNGYRERDLH----NRFKIPPFLTLKN-----------FEGIDLGKMDKANLEM-QAALMS--RQM----DASFNWEALRWLRDLWPHKLLVKGLLSAEDADRCIAEGADGVILSNHGGRQLDCAISPMEVLAQS-----VAKT-----GK--PVLIDSGFRRGSDIVKALALGAEAVLLGRATLYGLAARGETGVDEVLTLLKADIDRTLAQIGCPDITSLSPDYLQN-----------
2 PsiBlast_PDB 93.7037%-107 - C5 -1P4C GOX_SPIOL A:[6-355] ----------------------------------FNVEDYRKLAQKRLPKMVYDYLEGGAEDEYGVKHNRDVFQQWRFKPKRLVDVSRRSLQAEVLGKRQSMPLLIGPTGLNGA---LWP-KGDLALARAATK--AGIPFVLSTASNMSIEDLARQC---DGDL--WFQLYVIH-REIAQGMVLKALHTGYTTLVLTTDVAVNGYRERDLH----NRFKIPPFLTLKN-----------FEGIDLGKMDKANLEM-QAALMS--RQM----DASFNWEALRWLRDLWPHKLLVKGLLSAEDADRCIAEGADGVILSNHGGRQLDCAISPMEVLAQS-----VAKT-----GK--PVLIDSGFRRGSDIVKALALGAEAVLLGRATLYGLAARGETGVDEVLTLLKADIDRTLAQIGCPDITSLSPDYLQN-----------
3 PsiBlast_PDB 93.4737%-108 - C5 -1P5B GOX_SPIOL (first) A:[6-355] ----------------------------------FNVEDYRKLAQKRLPKMVYDYLEGGAEDEYGVKHNRDVFQQWRFKPKRLVDVSRRSLQAEVLGKRQSMPLLIGPTGLNGA---LWP-KGDLALARAATK--AGIPFVLSTASNMSIEDLARQC---DGDL--WFQLYVIH-REIAQGMVLKALHTGYTTLVLTTDVAVNGYRERDLH----NRFKIPPFLTLKN-----------FEGIDLGKMDKANLEM-QAALMS--RQM----DASFNWEALRWLRDLWPHKLLVKGLLSAEDADRCIAEGADGVILSNHGGRQLDCAISPMEVLAQS-----VAKT-----GK--PVLIDSGFRRGSDIVKALALGAEAVLLGRATLYGLAARGETGVDEVLTLLKADIDRTLAQIGCPDITSLSPDYLQN-----------
4 PsiBlast_PDB 93.4636%-110 - C5 -2A7N GOX_SPIOL A:[6-355] ----------------------------------FNVEDYRKLAQKRLPKMVYDYLEGGAEDEYGVKHNRDVFQQWRFKPKRLVDVSRRSLQAEVLGKRQSMPLLIGPTALNGA---LWP-KGDLALARAATK--AGIPFVLSTASNMSIEDLARQC---DGDL--WFQLYVIH-REIAQGMVLKALHTGYTTLVLTTDVAVNGYRERDLH----NRFKIPPFLTLKN-----------FEGIDLGKMDKANLEM-QAALMS--RQM----DASFNWEALRWLRDLWPHKLLVKGLLSAEDADRCIAEGADGVILSNHGGRQLDCAISPMEVLAQS-----VAKT-----GK--PVLIDSGFRRGSDIVKALALGAEAVLLGRATLYGLAARGETGVDEVLTLLKADIDRTLAQIGCPDITSLSPDYLQN-----------
6 PsiBlast_PDB 93.3436%-108 - C5 -2A85 GOX_SPIOL A:[6-355] ----------------------------------FNVEDYRKLAQKRLPKMVYDYLEGGAEDEYGVKHNRDVFQQWRFKPKRLVDVSRRSLQAEVLGKRQSMPLLIGPTALNGA---LWP-KGDLALARAATK--AGIPFVLSTASNMSIEDLARQC---DGDL--WFQLYVIH-REIAQGMVLKALHTGYTTLVLTTDVAVNGYRERDLH----NRFKIPPFLTLKN-----------FEGIDLGKMDKANLEM-QAALMS--RQM----DASFNWEALRWLRDLWPHKLLVKGLLSAEDADRCIAEGADGVILSNHGGRQLDCAISPMEVLAQS-----VAKT-----GK--PVLIDSGFRRGSDIVKALALGAEAVLLGRATLYGLAARGETGVDEVLTLLKADIDRTLAQIGCPDITSLSPDYLQN-----------
13 PsiBlast_PDB 93.0235%-116 - C5 -1AL8 GOX_SPIOL A:[5-354] -----------------------------------NVNEYEAIAKQKLPKMVYDYYASGAEDQWTLAENRNAFSRILFRPRILIDVTNIDMTTTILGFKISMPIMIAPTAMQKM---AHP-EGEYATARAASA--AGTIMTLSSWATSSVEEVASTGP---GIR--FFQLYVYKDRNVVAQLVRRAERAGFKAIALTVDTPRL------IK----NRFVLPPFLTLKNF----------------EGIDLG---------LS--SYVAGQIDRSLSWKDVAWLQTITSLPILVKGVITAEDARLAVQHGAAGIIVSNHGARQLDYVPATIMALEEV-----VKAA-----QGRIPVFLDGGVRRGTDVFKALALGAAGVFIGRPVVFSLAAEGEAGVKKVLQMMRDEFELTMALSGCRSLKEISRSHI-------------
12 PsiBlast_PDB 92.6035%-106 - C5 -1AL7 GOX_SPIOL A:[5-354] -----------------------------------NVNEYEAIAKQKLPKMVYDYYASGAEDQWTLAENRNAFSRILFRPRILIDVTNIDMTTTILGFKISMPIMIAPTAMQKM---AHP-EGEYATARAASA--AGTIMTLSSWATSSVEEVASTGP---GIR--FFQLYVYKDRNVVAQLVRRAERAGFKAIALTVDTPRLGRREADIK----NRFVLPPFLTLKNF----------------EGIDLG---------LS--SYVAGQIDRSLSWKDVAWLQTITSLPILVKGVITAEDARLAVQHGAAGIIVSNHGARQLDYVPATIMALEEV-----VKAA-----QGRIPVFLDGGVRRGTDVFKALALGAAGVFIGRPVVFSLAAEGEAGVKKVLQMMRDEFELTMALSGCRSLKEISRSHI-------------
1 PsiBlast_PDB 92.4237%-113 - C5 -1HUV GOX_SPIOL (first) A:[6-355] ----------------------------------FNVEDYRKLAQKRLPKMVYDYLEGGAEDEYGVKHNRDVFQQWRFKPKRLVDVSRRSLQAEVLGKRQSMPLLIGPTGLNGA---LWP-KGDLALARAATK--AGIPFVLSTASNMSIEDLARQC---DGDL--WFQLYVIH-REIAQGMVLKALHTGYTTLVLTTDVAVNGYRERDLH----NRFKIPPFLTLKN-----------FEGIDLGKMD----EM-QAALMS--RQM----DASFNWEALRWLRDLWPHKLLVKGLLSAEDADRCIAEGADGVILSNHGGRQLDCAISPMEVLAQS-----VAKT-----GK--PVLIDSGFRRGSDIVKALALGAEAVLLGRATLYGLAARGETGVDEVLTLLKADIDRTLAQIGCPDITSLSPDYLQN-----------
11 PsiBlast_PDB 91.8333%-110 - C5 -2RDW HAOX1_HUMAN A:[23-365] ----------------------------------ICINDYEQHAKSVLPKSIYDYYRSGANDEETLADNIAAFSRWKLYPRMLRNVAETDLSTSVLGQRVSMPICVGATAMQRM---AHV-DGELATVRACQS--LGTGMMLSSWATSSIEEVAEAGP--EALR--WLQLYIYKDREVTKKLVRQAEKMGYKAIFVTVDTPYLGNRLDDVR----NRFKLPPQLRMKN--------------FETSTLSFSPEEN-FGDDSGLAAYVAKAIDPSISWEDIKWLRRLTSLPIVAKGILRGDDAREAVKHGLNGILVSNHGARQLDGVPATIDVLPEI-----VEAV-----EGKVEVFLDGGVRKGTDVLKALALGAKAVFVGRPIVWGLAFQGEKGVQDVLEILKEEFRLAMALSG-------------------------
10 PsiBlast_PDB 91.4433%-109 - C5 -2RDU HAOX1_HUMAN A:[23-365] ----------------------------------ICINDYEQHAKSVLPKSIYDYYRSGANDEETLADNIAAFSRWKLYPRMLRNVAETDLSTSVLGQRVSMPICVGATAMQRM---AHV-DGELATVRACQS--LGTGMMLSSWATSSIEEVAEAGP--EALR--WLQLYIYKDREVTKKLVRQAEKMGYKAIFVTVDTPYLGNRLDDVR----NRFKLPPQLRMKN--------------FETSTLSFSPEEN-FGDDSGLAAYVAKAIDPSISWEDIKWLRRLTSLPIVAKGILRGDDAREAVKHGLNGILVSNHGARQLDGVPATIDVLPEI-----VEAV-----EGKVEVFLDGGVRKGTDVLKALALGAKAVFVGRPIVWGLAFQGEKGVQDVLEILKEEFRLAMALSG-------------------------
53 HHSearch 88.3634%-105 * C5 *3SGZ HAOX2_RAT A:[2-350] ---------------------------------LVCLADFKAHAQKQLSKTSWDFIEGEADDGITYSENIAAFKRIRLRPRYLRDMSKVDTRTTIQGQEISAPICISPTAFHSI---AWP-DGEKSTARAAQE--ANICYVISSYASYSLEDIVAAAP--EGFR--WFQLYMKSDWDFNKQMVQRAEALGFKALVITIDTPVLGNRRRDKR----NQLNLEANILKAA----L------------------------------------FPKASFCWNDLSLLQSITRLPIILKGILTKEDAELAMKHNVQGIVVSNHGGRQLDEVSASIDALREV-----VAAV-----KGKIEVYMDGGVRTGTDVLKALALGARCIFLGRPILWGLACKGEDGVKEVLDILTAELHRCMTLSGCQSVAEISPDLIQFS----------
55 HHSearch 88.1333%-100 - C5 -1KBI CYB2_YEAST A:[109-485] --------------------KEQLKSLLPPLDNIINLYDFEYLASQTLTKQAWAYYSSGANDEVTHRENHNAYHRIFFKPKILVDVRKVDISTDMLGSHVDVPFYVSATALCKL---GNPLEGEKDVARGCGQGVTKVPQMISTLASCSPEEIIEAAPSDKQIQ--WYQLYVNSDRKITDDLVKNVEKLGVKALFVTVDAPSLGQREKDMK----LKFSNT---------------------------KKTNVEE-SQGA-S--RALSKFIDPSLTWKDIEELKKKTKLPIVIKGVQRTEDVIKAAEIGVSGVVLSNHGGRQLDFSRAPIEVLAET-----MPILEQRNLKDKLEVFVDGGVRRGTDVLKALCLGAKGVGLGRPFLYANSCYGRNGVEKAIEILRDEIEMSMRLLGVTSIAELKPDLLDLSTLKA------
25 PsiBlast_CBE 87.8032%-106 - C5 -1TB3 HAOX2_RAT G:[3-349] ----------------------------------VCLADFKAHAQKQLSKTSWDFIEGEADDGITYSENIAAFKRIRLRPRYLRDMSKVDTRTTIQGQEISAPICISPTAFHSI---AWP-DGEKSTARAAQE--ANICYVISSYASYSLEDIVAAAP--EGFR--WFQLYMKSDWDFNKQMVQRAEALGFKALVITIDTPVLGNRRRDKR----NQLNLEA--------RALKE-------------------------------------ASFCWNDLSLLQSITRLPIILKGILTKEDAELAMKHNVQGIVVSNHGGRQLDEVSASIDALREV-----VAAV-----KGKIEVYMDGGVRTGTDVLKALALGARCIFLGRPILWGLACKGEDGVKEVLDILTAELHRCMTLSGCQSVAEISP-DLIQF----------
30 PsiBlast_CBE 87.6832%-106 - C5 -1TB3 HAOX2_RAT B:[3-349] ----------------------------------VCLADFKAHAQKQLSKTSWDFIEGEADDGITYSENIAAFKRIRLRPRYLRDMSKVDTRTTIQGQEISAPICISPTAFHSI---AWP-DGEKSTARAAQE--ANICYVISSYASYSLEDIVAAAP--EGFR--WFQLYMKSDWDFNKQMVQRAEALGFKALVITIDTPVLGNRRRDKR----NQLNLEA---------ALK--------------------------------------ASFCWNDLSLLQSITRLPIILKGILTKEDAELAMKHNVQGIVVSNHGGRQLDEVSASIDALREV-----VAAV-----KGKIEVYMDGGVRTGTDVLKALALGARCIFLGRPILWGLACKGEDGVKEVLDILTAELHRCMTLSGCQSVAEISP-DLIQF----------
28 PsiBlast_CBE 87.5432%-107 - C5 -1TB3 HAOX2_RAT D:[3-349] ----------------------------------VCLADFKAHAQKQLSKTSWDFIEGEADDGITYSENIAAFKRIRLRPRYLRDMSKVDTRTTIQGQEISAPICISPTAFHSI---AWP-DGEKSTARAAQE--ANICYVISSYASYSLEDIVAAAP--EGFR--WFQLYMKSDWDFNKQMVQRAEALGFKALVITIDTPVLGNRRRDKR----NQLNLEA-------LRALK--------------------------------------ASFCWNDLSLLQSITRLPIILKGILTKEDAELAMKHNVQGIVVSNHGGRQLDEVSASIDALREV-----VAAV-----KGKIEVYMDGGVRTGTDVLKALALGARCIFLGRPILWGLACKGEDGVKEVLDILTAELHRCMTLSGCQSVAEISP-DLIQF----------
29 PsiBlast_CBE 87.4032%-105 - C5 -1TB3 HAOX2_RAT C:[3-349] ----------------------------------VCLADFKAHAQKQLSKTSWDFIEGEADDGITYSENIAAFKRIRLRPRYLRDMSKVDTRTTIQGQEISAPICISPTAFHSI---AWP-DGEKSTARAAQE--ANICYVISSYASYSLEDIVAAAP--EGFR--WFQLYMKSDWDFNKQMVQRAEALGFKALVITIDTPVLGNRRRDKR----NQLNLEA----KD-LRALKE-------------------------------------ASFCWNDLSLLQSITRLPIILKGILTKEDAELAMKHNVQGIVVSNHGGRQLDEVSASIDALREV-----VAAV-----KGKIEVYMDGGVRTGTDVLKALALGARCIFLGRPILWGLACKGEDGVKEVLDILTAELHRCMTLSGCQSVAEISP-DLIQF----------
35 PsiBlast_CBE 87.0831%-107 - C5 -1SZF CYB2_YEAST B:[119-475] ------------------------------LDNIINLYDFEYLASQTLTKQAWAYYSSGANDEVTHRENHNAYHRIFFKPKILVDVRKVDISTDMLGSHVDVPFYVSATGLCKLGNPLEG-EKDVARGCGQGV--TKVPQMISTAASCSPEEIIEAAP--SDKQIQWYQLYVNSDRKITDDLVKNVEKLGVKALFVTVDAPSLGQREKDMKLKF-----------------------A----------------------------LSKFIDPSLTWKDIEELKKKTKLPIVIKGVQRTEDVIKAAEIGVSGVVLSNHGGRQLDFSRAPIEVLAETMPILEQRNL-----KDKLEVFVDGGVRRGTDVLKALCLGAKGVGLGRPFLYANSCYGRNGVEKAIEILRDEIEMSMRLLGVTSIAELKP----------------
50 PsiBlast_CBE 86.4631%-111 - C5 -1QCW CYB2_YEAST A:[18-374] ------------------------------LDNIINLYDFEYLASQTLTKQAWAYYSSGANDEVTHRENHNAYHRIFFKPKILVDVRKVDISTDMLGSHVDVPFYVSATALCKLGNPLEG-EKDVARGCGQGV--TKVPQMISTLASCSPEEIIEAAP--SDKQIQWYQLYVNSDRKITDDLVKNVEKLGVKALFVTVDAPSLGQKEKDMKLKFS-----------------------------------------------------KFIDPSLTWKDIEELKKKTKLPIVIKGVQRTEDVIKAAEIGVSGVVLSNHGGRQLDFSRAPIEVLAETMPILEQRNL-----KDKLEVFVDGGVRRGTDVLKALCLGAKGVGLGRPFLYANSCYGRNGVEKAIEILRDEIEMSMRLLGVTSIAELKP----------------
46 PsiBlast_CBE 86.3631%-106 - C5 -1SZE CYB2_YEAST A:[119-475] ------------------------------LDNIINLYDFEYLASQTLTKQAWAYYSSGANDEVTHRENHNAYHRIFFKPKILVDVRKVDISTDMLGSHVDVPFYVSATALCKLGNPLEG-EKDVARGCGQGV--TKVPQMISTAASCSPEEIIEAAP--SDKQIQWYQLYVNSDRKITDDLVKNVEKLGVKALFVTVDAPSLGQREKDMKLKF--------------------ASRA----------------------------LSKFIDPSLTWKDIEELKKKTKLPIVIKGVQRTEDVIKAAEIGVSGVVLSNHGGRQLDFSRAPIEVLAETMPILEQRNL-----KDKLEVFVDGGVRRGTDVLKALCLGAKGVGLGRPFLYANSCYGRNGVEKAIEILRDEIEMSMRLLGVTSIAELKP----------------
37 PsiBlast_CBE 85.9431%-110 - C5 -1KBI CYB2_YEAST A:[119-475] ------------------------------LDNIINLYDFEYLASQTLTKQAWAYYSSGANDEVTHRENHNAYHRIFFKPKILVDVRKVDISTDMLGSHVDVPFYVSATALCKLGNPLEG-EKDVARGCGQGV--TKVPQMISTLASCSPEEIIEAAP--SDKQIQWYQLYVNSDRKITDDLVKNVEKLGVKALFVTVDAPSLGQREKDMKLKFSNT-------KKTNVEESQGASRA----------------------------LSKFIDPSLTWKDIEELKKKTKLPIVIKGVQRTEDVIKAAEIGVSGVVLSNHGGRQLDFSRAPIEVLAETMPILEQRNL-----KDKLEVFVDGGVRRGTDVLKALCLGAKGVGLGRPFLYANSCYGRNGVEKAIEILRDEIEMSMRLLGVTSIAELKP----------------
49 PsiBlast_CBE 85.8831%-110 - C5 -1QCW CYB2_YEAST B:[18-374] ------------------------------LDNIINLYDFEYLASQTLTKQAWAYYSSGANDEVTHRENHNAYHRIFFKPKILVDVRKVDISTDMLGSHVDVPFYVSATALCKLGNPLEG-EKDVARGCGQGV--TKVPQMISTLASCSPEEIIEAAP--SDKQIQWYQLYVNSDRKITDDLVKNVEKLGVKALFVTVDAPSLGQKEKDMKLKFS-----------------------------------------------------KFIDPSLTWKDIEELKKKTKLPIVIKGVQRTEDVIKAAEIGVSGVVLSNHGGRQLDFSRAPIEVLAETMPILEQRNL-----KDKLEVFVDGGVRRGTDVLKALCLGAKGVGLGRPFLYANSCYGRNGVEKAIEILRDEIEMSMRLLGVTSIAELKP----------------
38 PsiBlast_CBE 85.6731%-106 - C5 -1FCB CYB2_YEAST B:[119-475] ------------------------------LDNIINLYDFEYLASQTLTKQAWAYYSSGANDEVTHRENHNAYHRIFFKPKILVDVRKVDISTDMLGSHVDVPFYVSATALCKLGNPLEG-EKDVARGCGQGV--TKVPQMISTLASCSPEEIIEAAP--SDKQIQWYQLYVNSDRKITDDLVKNVEKLGVKALFVTVDAPSLGQREKDMKLKFS------------NVEESQGASRA----------------------------LSKFIDPSLTWKDIEELKKKTKLPIVIKGVQRTEDVIKAAEIGVSGVVLSNHGGRQLDFSRAPIEVLAETMPILEQRNL-----KDKLEVFVDGGVRRGTDVLKALCLGAKGVGLGRPFLYANSCYGRNGVEKAIEILRDEIEMSMRLLGVTSIAELKP----------------
36 PsiBlast_CBE 85.4831%-108 - C5 -1KBI CYB2_YEAST B:[119-475] ------------------------------LDNIINLYDFEYLASQTLTKQAWAYYSSGANDEVTHRENHNAYHRIFFKPKILVDVRKVDISTDMLGSHVDVPFYVSATALCKLGNPLEG-EKDVARGCGQGV--TKVPQMISTLASCSPEEIIEAAP--SDKQIQWYQLYVNSDRKITDDLVKNVEKLGVKALFVTVDAPSLGQREKDMKLKFSNT--------KTNVEESQGASRA----------------------------LSKFIDPSLTWKDIEELKKKTKLPIVIKGVQRTEDVIKAAEIGVSGVVLSNHGGRQLDFSRAPIEVLAETMPILEQRNL-----KDKLEVFVDGGVRRGTDVLKALCLGAKGVGLGRPFLYANSCYGRNGVEKAIEILRDEIEMSMRLLGVTSIAELKP----------------
44 PsiBlast_CBE 84.9931%-107 - C5 -1LCO CYB2_YEAST A:[119-475] ------------------------------LDNIINLYDFEYLASQTLTKQAWAFYSSGANDEVTHRENHNAYHRIFFKPKILVDVRKVDISTDMLGSHVDVPFYVSATALCKLGNPLEG-EKDVARGCGQGV--TKVPQMISTLASCSPEEIIEAAP--SDKQIQWYQLYVNSDRKITDDLVKNVEKLGVKALFVTVDAPSLGQREKDMKLKFS----------------------A----------------------------LSKFIDPSLTWKDIEELKKKTKLPIVIKGVQRTEDVIKAAEIGVSGVVLSNHGGRQLDFSRAPIEVLAETMPILEQRNL-----KDKLEVFVDGGVRRGTDVLKALCLGAKGVGLGRPFLYANSCYGRNGVEKAIEILRDEIEMSMRLLGVTSIAELKP----------------
42 PsiBlast_CBE 84.8231%-106 - C5 -1LDC CYB2_YEAST A:[119-475] ------------------------------LDNIINLYDFEYLASQTLTKQAWAFYSSGANDEVTHRENHNAYHRIFFKPKILVDVRKVDISTDMLGSHVDVPFYVSATALCKLGNPLEG-EKDVARGCGQGV--TKVPQMISTLASCSPEEIIEAAP--SDKQIQWYQLYVNSDRKITDDLVKNVEKLGVKALFVTVDAPSLGQREKDMKLK------------------------A----------------------------LSKFIDPSLTWKDIEELKKKTKLPIVIKGVQRTEDVIKAAEIGVSGVVLSNHGGRQLDFSRAPIEVLAETMPILEQRNL-----KDKLEVFVDGGVRRGTDVLKALCLGAKGVGLGRPFLYANSCYGRNGVEKAIEILRDEIEMSMRLLGVTSIAELKP----------------