@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Rv1880c: (2016-05-05 )
MKDKLHWLAMHGVIRGIAAIGIRRGDLQARLIADPAVATDPVPFYDEVRSHGALVRNRANYLTVDHRLAHDLLRSDDFRVVSFGENLPPPLRWLERRTRGDQLHPLREPSLLAVEPPDHTRYRKTVSAVFTSRAVSALRDLVEQTAINLLDRFAEQPGIVDVVGRYCSQLPIVVISEILGVPEHDRPRVLEFGELAAPSLDIGIPWRQYLRVQQGIRGFDCWLEGHLQQLRHAPGDDLMSQLIQIAESGDNETQLDETELRAIAGLVLVAGFETTVNLLGNGIRMLLDTPEHLATLRQHPELWPNTVEEILRLDSPVQLTARVACRDVEVAGVRIKRGEVVVIYLAAANRDPAVFPDPHRFDIERPNAGRHLAFSTGRHFCLGAALARAEGEVGLRTFFDRFPDVRAAGAGSRRDTRVLRGWSTLPVTLGPARSMVSP

Atome Classification :

(62 SA) .........10........20........30--........40........-----50........-----60-----.........70........80........90........100.......110..--------.....120.......130.......140.......150....-.-..160.......170.......180.......190----------------..------...--....200.........210--.-........220.......230.......240....-...250.......260.......270.......280.......290......-.300.......310---.....-.-.320-........330-...-....340.......350.......360...-.-...370.......380.......390...-....400....---.---..--410-..--.---......420------.......430......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MKDKLHWLAMHGVIRGIAAIGIRRGDLQARL--IADPAVATDPVPFYDEVR-----SHGALVRNRA-----N------YLTVDHRLAHDLLRSDDFRVVSFGENLPPPLRWLERRTRGDQLHPLREPSLLAV--------EPPDHTRYRKTVSAVFTSRAVSALRDLVEQTAINLLDRFAEQ-P-GIVDVVGRYCSQLPIVVISEILGVPEHDRPRVL------------------EF------GEL--AAPSL--DIGIPWRQYL----R-VQQGIRGFDCWLEGHLQQLRHAPGDDLMSQLIQIA-ESGDNETQLDETELRAIAGLVLVAGFETTVNLLGNGIRMLLDTPEHLATLRQ-HPELWPNTVEEILR---LDSPV-Q-LTA--RVACRDVEVAG-VRI-KRGEVVVIYLAAANRDPAVFPDPHRFDIER-P-NAGRHLAFSTGRHFCLGAALARAEGEVGL-RTFFDRFPDVR---A---AG--A---GS--R---RDTRVLRGW------STLPVTLGPARSMVSP
140 HHSearch 92.4335% -99 * C7 *3ZPI PIKC_STRVZ A:[47-426] -----------------------------------------DPYPTYARLR-----AEGPAHRVRTPEGNEV------WLVVGYDRARAVLADPRFSKDWRNS-----TTPL------TEAEAALNHNMLES--------DPPRHTRLRKLVAREFTMRRVELLRPRVQEIVDGLVDAMLAAPD-GRADLMESLAWPLPITVISELLGVPEPDRAAFR------------------VW------TDA--FV--------FPD-DPA----Q-AQTAMAEMSGYLSRLIDSKRGQDGEDLLSALVRTS-D--EDGSRLTSEELLGMAHILLVAGHETTVNLIANGMYALLSHPDQLAALRA-DMTLLDGAVEEMLR---YEGPV-ESATY--RFPVEPVDLDG-TVI-PAGDTVLVVLADAHRTPERFPDPHRFDIRR-D-T-AGHLAFGHGIHFCIGAPLARLEARIAV-RALLERCPDLA---L---DVSPGE--LV--W---YPNPMIRGL------KALPIRWR--------
53 PsiBlast_CBE 92.3934%-102 - C7 -2BVJ PIKC_STRVZ B:[45-423] ---------------------------------------AADPYPTYARLR-----AEGPAHRVRT-----PEGDEV-WLVVGYDRARAVLADPRFSK-----------DWRNSTTPL------LNHNMLES--------DPPRHTRLRKLVAREFTMRRVELLRPRVQEIVDGLVDAMLAA-PDGRADLMESLAWPLPITVISELLGVPEPDRAAFR------------------VW------TDA--FVFPD--DPA-----------Q-AQTAMAEMSGYLSRLIDSKRGQDGEDLLSALVRT---SDEDGSRLTSEELLGMAHILLVAGHETTVNLIANGMYALLSHPDQLAALRA-DMTLLDGAVEEMLR---YEGPV-ESATY--RFPVEPVDLDG-TVI-PAGDTVLVVLADAHRTPERFPDPHRFDIRR-D-TAG-HLAFGHGIHFCIGAPLARLEARIAV-RALLERCPDLALDVS---PG--E---LV--W---YPNPMIRGL------KALPI-----------
76 PsiBlast_CBE 92.2834% -95 - C7 -3ZPI PIKC_STRVZ A:[45-423] ---------------------------------------AADPYPTYARLR-----AEGPAHRVRT-----PEGNEV-WLVVGYDRARAVLADPRFSK-----------DWRNSTTPLTEAEAALNHNMLES--------DPPRHTRLRKLVAREFTMRRVELLRPRVQEIVDGLVDAMLAA-PDGRADLMESLAWPLPITVISELLGVPEPDRAAFR------------------VW------TDA--FVFPD--DPA-----------Q-AQTAMAEMSGYLSRLIDSKRGQDGEDLLSALVRT---SDEDGSRLTSEELLGMAHILLVAGHETTVNLIANGMYALLSHPDQLAALRA-DMTLLDGAVEEMLR---YEGPV-ESATY--RFPVEPVDLDG-TVI-PAGDTVLVVLADAHRTPERFPDPHRFDIRR-D-TAG-HLAFGHGIHFCIGAPLARLEARIAV-RALLERCPDLALDVS---PG--E---LV--W---YPNPMIRGL------KALPI-----------
70 PsiBlast_CBE 92.0234% -96 - C7 -4BF4 PIKC_STRVZ C:[45-423] ---------------------------------------AADPYPTYARLR-----AEGPAHRVRT-----PEGNEV-WLVVGYDRARAVLADPRFSK-----------DWRNSTTPLTEAEAALNHNMLES--------DPPRHTRLRKLVAREFTMRRVELLRPRVQEIVDGLVDAMLAA-PDGRADLMESLAWPLPITVISELLGVPEPDRAAFR------------------VW------TDA--FVFPD--DPA-----------Q-AQTAMAEMSGYLSRLIDSKRGQDGEDLLSALVRT---SDEDGSRLTSEELLGMAHILLVAGHETTVNLIANGMYALLSHPDQLAALRA-DMTLLDGAVEEMLR---YEGPV-ESATY--RFPVEPVDLDG-TVI-PAGDTVLVVLADAHRTPERFPDPHRFDIRR-D-TAG-HLAFGHGIHFCIGAPLARLEARIAV-RALLERCPDLALDVS---PG--E---LV--W---YPNPMIRGL------KALPI-----------
68 PsiBlast_CBE 91.9234% -97 - C7 -4BF4 PIKC_STRVZ E:[45-423] ---------------------------------------AADPYPTYARLR-----AEGPAHRVRT-----PEGNEV-WLVVGYDRARAVLADPRFSK-----------DWRNSTTPLTEAEAALNHNMLES--------DPPRHTRLRKLVAREFTMRRVELLRPRVQEIVDGLVDAMLAA-PDGRADLMESLAWPLPITVISELLGVPEPDRAAFR------------------VW------TDA--FVFPD--DPA-----------Q-AQTAMAEMSGYLSRLIDSKRGQDGEDLLSALVRT---SDEDGSRLTSEELLGMAHILLVAGHETTVNLIANGMYALLSHPDQLAALRA-DMTLLDGAVEEMLR---YEGPV-ESATY--RFPVEPVDLDG-TVI-PAGDTVLVVLADAHRTPERFPDPHRFDIRR-D-TAG-HLAFGHGIHFCIGAPLARLEARIAV-RALLERCPDLALDVS---PG--E---LV--W---YPNPMIRGL------KALPI-----------
139 HHSearch 91.6734%-104 - C7 -3A4G CPVDH_PSEAH A:[18-403] --------------------------------------FWQNPHPAYAALR-----AEDPVRKLALPDGP-V------WLLTRYADVREAFVDPRLSKDWRHTL-PE-DQR-------ADMPATPTPMMILM--------DPPDHTRLRKLVGRSFTVRRMNELEPRITEIADGLLAGLPT--D-GPVDLMREYAFQIPVQVICELLGVPAEDRDDFS------------------AW------SSV--LVD------DSPAD-------D-KNAAMGKLHGYLSDLLERKRTEPDDALLSSLLAVS-D--EDGDRLSQEELVAMAMLLLIAGHETTVNLIGNGVLALLTHPDQRKLLAE-DPSLISSAVEEFLR---FDSPV-SQAPI--RFTAEDVTYSG-VTI-PAGEMVMLGLAAANRDADWMPEPDRLDITR-D-A-SGGVFFGHGIHFCLGAQLARLEGRVAI-GRLFADRPELA---L---AV--GLDELV--Y---RESTLVRGL------SRMPVTMGPRSA----
84 PsiBlast_CBE 91.6434% -98 - C7 -2WI9 PIKC_STRVZ A:[45-423] ---------------------------------------AADPYPTYARLR-----AEGPAHRVRT-----PEGNEV-WLVVGYDRARAVLADPRFSK-----------DWRNSTTPLTEAEAALNHNMLES--------DPPRHTRLRKLVAREFTMRRVELLRPRVQEIVDGLVDAMLAA-PDGRADLMESLAWPLPITVISELLGVPEPDRAAFR------------------VW------TDA--FVFPD--DPA-----------Q-AQTAMAEMSGYLSRLIDSKRGQDGEDLLSALVRT---SDEDGSRLTSEELLGMAHILLVAGHETTVNLIANGMYALLSHPDQLAALRA-DMTLLDGAVEEMLR---YEGPV-ESATY--RFPVEPVDLDG-TVI-PAGDTVLVVLADAHRTPERFPDPHRFDIRR-D-TAG-HLAFGHGIHFCIGAPLARLEARIAV-RALLERCPDLALDVS---PG--E---LV--W---YPNPMIRGL------KALPI-----------
66 PsiBlast_CBE 91.6334% -98 - C7 -4BF4 PIKC_STRVZ G:[45-423] ---------------------------------------AADPYPTYARLR-----AEGPAHRVRT-----PEGNEV-WLVVGYDRARAVLADPRFSK-----------DWRNSTTPLTEAEAALNHNMLES--------DPPRHTRLRKLVAREFTMRRVELLRPRVQEIVDGLVDAMLAA-PDGRADLMESLAWPLPITVISELLGVPEPDRAAFR------------------VW------TDA--FVFPD--DPA-----------Q-AQTAMAEMSGYLSRLIDSKRGQDGEDLLSALVRT---SDEDGSRLTSEELLGMAHILLVAGHETTVNLIANGMYALLSHPDQLAALRA-DMTLLDGAVEEMLR---YEGPV-ESATY--RFPVEPVDLDG-TVI-PAGDTVLVVLADAHRTPERFPDPHRFDIRR-D-TAG-HLAFGHGIHFCIGAPLARLEARIAV-RALLERCPDLALDVS---PG--E---LV--W---YPNPMIRGL------KALPI-----------
85 PsiBlast_CBE 91.6234% -97 - C7 -2WHW PIKC_STRVZ B:[45-423] ---------------------------------------AADPYPTYARLR-----AEGPAHRVRT-----PEGNEV-WLVVGYDRARAVLADPRFSK-----------DWRNSTTPLTEAEAALNHNMLES--------DPPRHTRLRKLVAREFTMRRVELLRPRVQEIVDGLVDAMLAA-PDGRADLMESLAWPLPITVISELLGVPEPDRAAFR------------------VW------TDA--FVFPD--DPA-----------Q-AQTAMAEMSGYLSRLIDSKRGQDGEDLLSALVRT---SDEDGSRLTSEELLGMAHILLVAGHETTVNLIANGMYALLSHPDQLAALRA-DMTLLDGAVEEMLR---YEGPV-ESATY--RFPVEPVDLDG-TVI-PAGDTVLVVLADAHRTPERFPDPHRFDIRR-D-TAG-HLAFGHGIHFCIGAPLARLEARIAV-RALLERCPDLALDVS---PG--E---LV--W---YPNPMIRGL------KALPI-----------
80 PsiBlast_CBE 91.6234% -99 - C7 -2VZM PIKC_STRVZ A:[45-423] ---------------------------------------AADPYPTYARLR-----AEGPAHRVRT-----PEGNEV-WLVVGYDRARAVLADPRFSK-----------DWRNSTTPLTEAEAALNHNMLES--------DPPRHTRLRKLVAREFTMRRVELLRPRVQEIVDGLVDAMLAA-PDGRADLMESLAWPLPITVISELLGVPEPDRAAFR------------------VW------TDA--FVFPD--DPA-----------Q-AQTAMAEMSGYLSRLIDSKRGQDGEDLLSALVRT---SDEDGSRLTSEELLGMAHILLVAGHETTVNLIANGMYALLSHPDQLAALRA-DMTLLDGAVEEMLR---YEGPV-ESATY--RFPVEPVDLDG-TVI-PAGDTVLVVLADAHRTPERFPDPHRFDIRR-D-TAG-HLAFGHGIHFCIGAPLARLEARIAV-RALLERCPDLALDVS---PG--E---LV--W---YPNPMIRGL------KALPI-----------
50 PsiBlast_CBE 91.5034% -95 - C7 -2C7X PIKC_STRVZ A:[45-423] ---------------------------------------AADPYPTYARLR-----AEGPAHRVRT-----PEGDEV-WLVVGYDRARAVLADPRFSK-----------DWRNSTTPLTEAEAALNHNMLES--------DPPRHTRLRKLVAREFTMRRVELLRPRVQEIVDGLVDAMLAA-PDGRADLMESLAWPLPITVISELLGVPEPDRAAFR------------------VW------TDA--FVFPD--DPA-----------Q-AQTAMAEMSGYLSRLIDSKRGQDGEDLLSALVRT---SDEDGSRLTSEELLGMAHILLVAGHETTVNLIANGMYALLSHPDQLAALRA-DMTLLDGAVEEMLR---YEGPV-ESATY--RFPVEPVDLDG-TVI-PAGDTVLVVLADAHRTPERFPDPHRFDIRR-D-TAG-HLAFGHGIHFCIGAPLARLEARIAV-RALLERCPDLALDVS---PG--E---LV--W---YPNPMIRGL------KALPI-----------
74 PsiBlast_CBE 91.4734% -98 - C7 -4B7S PIKC_STRVZ A:[45-423] ---------------------------------------AADPYPTYARLR-----AEGPAHRVRT-----PEGNEV-WLVVGYDRARAVLADPRFSK-----------DWRNSTTPLTEAEAALNHNMLES--------DPPRHTRLRKLVAREFTMRRVELLRPRVQEIVDGLVDAMLAA-PDGRADLMESLAWPLPITVISELLGVPEPDRAAFR------------------VW------TDA--FVFPD--DPA-----------Q-AQTAMAEMSGYLSRLIDSKRGQDGEDLLSALVRT---SDEDGSRLTSEELLGMAHILLVAGHETTVNLIANGMYALLSHPDQLAALRA-DMTLLDGAVEEMLR---YEGPV-ESATY--RFPVEPVDLDG-TVI-PAGDTVLVVLADAHRTPERFPDPHRFDIRR-D-TAG-HLAFGHGIHFCIGAPLARLEARIAV-RALLERCPDLALDVS---PG--E---LV--W---YPNPMIRGL------KALPI-----------
83 PsiBlast_CBE 91.4634% -98 - C7 -2WI9 PIKC_STRVZ B:[45-423] ---------------------------------------AADPYPTYARLR-----AEGPAHRVRT-----PEGNEV-WLVVGYDRARAVLADPRFSK-----------DWRNSTTPLTEAEAALNHNMLES--------DPPRHTRLRKLVAREFTMRRVELLRPRVQEIVDGLVDAMLAA-PDGRADLMESLAWPLPITVISELLGVPEPDRAAFR------------------VW------TDA--FVFPD--DPA-----------Q-AQTAMAEMSGYLSRLIDSKRGQDGEDLLSALVRT---SDEDGSRLTSEELLGMAHILLVAGHETTVNLIANGMYALLSHPDQLAALRA-DMTLLDGAVEEMLR---YEGPV-ESATY--RFPVEPVDLDG-TVI-PAGDTVLVVLADAHRTPERFPDPHRFDIRR-D-TAG-HLAFGHGIHFCIGAPLARLEARIAV-RALLERCPDLALDVS---PG--E---LV--W---YPNPMIRGL------KALPI-----------