@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Rv1938: (2016-05-06 )
MSQVHRILNCRGTRIHAVADSPPDQQGPLVVLLHGFPESWYSWRHQIPALAGAGYRVVAIDQRGYGRSSKYRVQKAYRIKELVGDVVGVLDSYGAEQAFVVGHDWGAPVAWTFAWLHPDRCAGVVGISVPFAGRGVIGLPGSPFGERRPSDYHLELAGPGRVWYQDYFAVQDGIITEIEEDLRGWLLGLTYTVSGEGMMAATKAAVDAGVDLESMDPIDVIRAGPLCMAEGARLKDAFVYPETMPAWFTEADLDFYTGEFERSGFGGPLSFYHNIDNDWHDLADQQGKPLTPPALFIGGQYDVGTIWGAQAIERAHEVMPNYRGTHMIADVGHWIQQEAPEETNRLLLDFLGGLRP

Atome Classification :

(45 SA) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------.........10........20........30........40........50........60........70.--.......80........90...--.....100.......110.......120.......130.......140.......150.......160.-......170.......180.......190.......200.......210.......220.......230.......240.......250.......260.......270.......280.......290.......300.......310.......320.......330.......340.......350....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MSQVHRILNCRGTRIHAVADSPPDQQGPLVVLLHGFPESWYSWRHQIPALAGAGYRVVAIDQRGYGRSSKYR--VQKAYRIKELVGDVVGVLDSYG--AEQAFVVGHDWGAPVAWTFAWLHPDRCAGVVGISVPFAGRGVIGLPGSPFGERRPSDYHLELAGPGRVW-YQDYFAVQDGIITEIEEDLRGWLLGLTYTVSGEGMMAATKAAVDAGVDLESMDPIDVIRAGPLCMAEGARLKDAFVYPETMPAWFTEADLDFYTGEFERSGFGGPLSFYHNIDNDWHDLADQQGKPLTPPALFIGGQYDVGTIWGAQAIERAHEVMPNYRGTHMIADVGHWIQQEAPEETNRLLLDFLGGLRP
2 PsiBlast_PDB 92.0299%-113 - C1 -2E3J ? A:[4-356] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------VHRILNCRGTRIHAVADSPPDQQGPLVVLLHGFPESWYSWRHQIPALAGAGYRVVAIDQRGYGRSSKYR--VQKAYRIKELVGDVVGVLDSYG--AEQAFVVGHDWGAPVAWTFAWLHPDRCAGVVGISVPFAGRGVIGLPGSPFGERRPSDYHLELAGPGRVW-YQDYFAVQDGIITEIEEDLRGWLLGLTYTVSGEGMMAATKAAV-------SMDPIDVIRAGPLCMAEGARLKDAFVYPETMPAWFTEADLDFYTGEFERSGFGGPLSFYHNIDNDWHDLADQQGKPLTPPALFIGGQYDVGTIWGAQAIERAHEVMPNYRGTHMIADVGHWIQQEAPEETNRLLLDFLGGLRP
1 PsiBlast_PDB 91.9899%-114 - C1 -2ZJF ? A:[10-362] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------VHRILNCRGTRIHAVADSPPDQQGPLVVLLHGFPESWYSWRHQIPALAGAGYRVVAIDQRGYGRSSKYR--VQKAYRIKELVGDVVGVLDSYG--AEQAFVVGHDWGAPVAWTFAWLHPDRCAGVVGISVPFAGRGVIGLPGSPFGERRPSDYHLELAGPGRVW-YQDYFAVQDGIITEIEEDLRGWLLGLTYTVSGEGMMAATKAAV-------SMDPIDVIRAGPLCMAEGARLKDAFVYPETMPAWFTEADLDFYTGEFERSGFGGPLSFYHNIDNDWHDLADQQGKPLTPPALFIGGQYDVGTIWGAQAIERAHEVMPNYRGTHMIADVGHWIQQEAPEETNRLLLDFLGGLRP
102 Fugue 60.2030%-101 * C1 *1EK1 HYES_MOUSE A:[4-544] RVAAFDLDGVLALPSIGPTEQLMKGKITFSQWVPLQIFSQAMAARSINRPMLQAAIALKKKGFTTCIVTNNWLDDGDKRDSLAQMMCELSQHFDFLIESCQVGMIKPEPQIYNFLLDTLKAKPNEVVFLDDFGSNLKPARDMGMVTILVHNTASALRELEKVTGTQFPEAPLPVPCNPNDVSHGYVTVKPGIRLHFVEMGS----GPALCLCHGFPESWFSWRYQIPALAQAGFRVLAIDMKGYGDSSSPP--EIEEYAMELLCKEMVTFLDKLG--IPQAVFIGHDWAGVMVWNMALFYPERVRAVASLNTPFMPPD------------PDVSPMKVIRSIPVFN-YQLYFQEPGVAEAELEKNMSRTFKSFFRASDETGFIAVHKATEIGGILVNTPEDPN------------------------LSKITTEEEIEFYIQQFKKTGFRGPLNWYRNTERNWKWSCKGLGRKILVPALMVTAEKD--IVLRPEMSKNMEKWIPFL-KRGHIEDCGHWTQIEKPTEVNQILIKWLQTE--
11 PsiBlast_PDB 60.0032%-105 - C1 -1VJ5 HYES_HUMAN A:[258-542] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPP--EIEEYCMEVLCKEMVTFLDKLG--LSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPF-------IPAN------PNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSL-FRASDESVLSMHKVCEAGGLFVNSPEEPSLSRM------------------------VTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLV--PQMSQHMEDWIPHLKRGH-IEDCGHWTQMDKPTEVNQILIKWL-----
70 PsiBlast_CBE 59.7932%-106 - C1 -5ALO HYES_HUMAN A:[259-543] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPP--EIEEYCMEVLCKEMVTFLDKLG--LSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPF-------IPAN------PNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSL-FRASDESVLSMHKVCEAGGLFVNSPEEPSLSRM------------------------VTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLV--PQMSQHMEDWIPHLKRGH-IEDCGHWTQMDKPTEVNQILIKWL-----
69 PsiBlast_CBE 59.7632%-106 - C1 -5ALP HYES_HUMAN A:[259-543] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPP--EIEEYCMEVLCKEMVTFLDKLG--LSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPF-------IPAN------PNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSL-FRASDESVLSMHKVCEAGGLFVNSPEEPSLSRM------------------------VTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLV--PQMSQHMEDWIPHLKRGH-IEDCGHWTQMDKPTEVNQILIKWL-----
83 PsiBlast_CBE 59.6832%-104 - C1 -5AKY HYES_HUMAN A:[259-543] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPP--EIEEYCMEVLCKEMVTFLDKLG--LSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPF-------IPAN------PNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSL-FRASDESVLSMHKVCEAGGLFVNSPEEPSLSRM------------------------VTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLV--PQMSQHMEDWIPHLKRGH-IEDCGHWTQMDKPTEVNQILIKWL-----
27 PsiBlast_CBE 59.6532%-107 - C1 -4Y2Y HYES_HUMAN A:[258-542] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPP--EIEEYCMEVLCKEMVTFLDKLG--LSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPF-------IPAN------PNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSL-FRASDESVLSMHKVCEAGGLFVNSPEEPSLSRM------------------------VTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLV--PQMSQHMEDWIPHLKRGH-IEDCGHWTQMDKPTEVNQILIKWL-----
80 PsiBlast_CBE 59.6432%-106 - C1 -5ALE HYES_HUMAN A:[259-543] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPP--EIEEYCMEVLCKEMVTFLDKLG--LSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPF-------IPAN------PNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSL-FRASDESVLSMHKVCEAGGLFVNSPEEPSLSRM------------------------VTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLV--PQMSQHMEDWIPHLKRGH-IEDCGHWTQMDKPTEVNQILIKWL-----
79 PsiBlast_CBE 59.6432%-106 - C1 -5ALF HYES_HUMAN A:[259-543] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPP--EIEEYCMEVLCKEMVTFLDKLG--LSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPF-------IPAN------PNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSL-FRASDESVLSMHKVCEAGGLFVNSPEEPSLSRM------------------------VTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLV--PQMSQHMEDWIPHLKRGH-IEDCGHWTQMDKPTEVNQILIKWL-----
46 PsiBlast_CBE 59.6432%-107 - C1 -3WK8 HYES_HUMAN A:[258-542] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPP--EIEEYCMEVLCKEMVTFLDKLG--LSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPF-------IPAN------PNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSL-FRASDESVLSMHKVCEAGGLFVNSPEEPSLSRM------------------------VTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLV--PQMSQHMEDWIPHLKRGH-IEDCGHWTQMDKPTEVNQILIKWL-----
100 PsiBlast_CBE 59.6332%-106 - C1 -5AI8 HYES_HUMAN A:[259-543] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPP--EIEEYCMEVLCKEMVTFLDKLG--LSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPF-------IPAN------PNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSL-FRASDESVLSMHKVCEAGGLFVNSPEEPSLSRM------------------------VTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLV--PQMSQHMEDWIPHLKRGH-IEDCGHWTQMDKPTEVNQILIKWL-----
42 PsiBlast_CBE 59.6332%-108 - C1 -3WKC HYES_HUMAN A:[258-542] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPP--EIEEYCMEVLCKEMVTFLDKLG--LSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPF-------IPAN------PNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSL-FRASDESVLSMHKVCEAGGLFVNSPEEPSLSRM------------------------VTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLV--PQMSQHMEDWIPHLKRGH-IEDCGHWTQMDKPTEVNQILIKWL-----
96 PsiBlast_CBE 59.5932%-105 - C1 -5AIC HYES_HUMAN A:[259-543] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPP--EIEEYCMEVLCKEMVTFLDKLG--LSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPF-------IPAN------PNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSL-FRASDESVLSMHKVCEAGGLFVNSPEEPSLSRM------------------------VTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLV--PQMSQHMEDWIPHLKRGH-IEDCGHWTQMDKPTEVNQILIKWL-----
99 PsiBlast_CBE 59.5032%-105 - C1 -5AI9 HYES_HUMAN A:[259-543] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPP--EIEEYCMEVLCKEMVTFLDKLG--LSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPF-------IPAN------PNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSL-FRASDESVLSMHKVCEAGGLFVNSPEEPSLSRM------------------------VTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLV--PQMSQHMEDWIPHLKRGH-IEDCGHWTQMDKPTEVNQILIKWL-----
55 PsiBlast_CBE 59.5032%-108 - C1 -5AM4 HYES_HUMAN A:[259-543] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPP--EIEEYCMEVLCKEMVTFLDKLG--LSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPF-------IPAN------PNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSL-FRASDESVLSMHKVCEAGGLFVNSPEEPSLSRM------------------------VTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLV--PQMSQHMEDWIPHLKRGH-IEDCGHWTQMDKPTEVNQILIKWL-----
54 PsiBlast_CBE 59.4632%-105 - C1 -5AM5 HYES_HUMAN A:[259-543] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPP--EIEEYCMEVLCKEMVTFLDKLG--LSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPF-------IPAN------PNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSL-FRASDESVLSMHKVCEAGGLFVNSPEEPSLSRM------------------------VTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLV--PQMSQHMEDWIPHLKRGH-IEDCGHWTQMDKPTEVNQILIKWL-----
48 PsiBlast_CBE 59.3832%-108 - C1 -3WK6 HYES_HUMAN A:[258-542] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPP--EIEEYCMEVLCKEMVTFLDKLG--LSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPF-------IPAN------PNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSL-FRASDESVLSMHKVCEAGGLFVNSPEEPSLSRM------------------------VTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLV--PQMSQHMEDWIPHLKRGH-IEDCGHWTQMDKPTEVNQILIKWL-----
44 PsiBlast_CBE 59.3832%-107 - C1 -3WKA HYES_HUMAN A:[258-542] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPP--EIEEYCMEVLCKEMVTFLDKLG--LSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPF-------IPAN------PNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSL-FRASDESVLSMHKVCEAGGLFVNSPEEPSLSRM------------------------VTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLV--PQMSQHMEDWIPHLKRGH-IEDCGHWTQMDKPTEVNQILIKWL-----
10 PsiBlast_PDB 59.3632%-102 - C1 -1S8O HYES_HUMAN A:[258-542] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPP--EIEEYCMEVLCKEMVTFLDKLG--LSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPF-------IPAN------PNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSL-FRASDESVLSMHKVCEAGGLFVNSPEEPSLSRM------------------------VTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLV--PQMSQHMEDWIPHLKRGH-IEDCGHWTQMDKPTEVNQILIKWL-----
82 PsiBlast_CBE 59.2632%-106 - C1 -5AKZ HYES_HUMAN A:[259-543] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPP--EIEEYCMEVLCKEMVTFLDKLG--LSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPF-------IPAN------PNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSL-FRASDESVLSMHKVCEAGGLFVNSPEEPSLSRM------------------------VTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLV--PQMSQHMEDWIPHLKRGH-IEDCGHWTQMDKPTEVNQILIKWL-----
68 PsiBlast_CBE 59.2332%-106 - C1 -5ALQ HYES_HUMAN A:[259-543] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPP--EIEEYCMEVLCKEMVTFLDKLG--LSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPF-------IPAN------PNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSL-FRASDESVLSMHKVCEAGGLFVNSPEEPSLSRM------------------------VTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLV--PQMSQHMEDWIPHLKRGH-IEDCGHWTQMDKPTEVNQILIKWL-----
45 PsiBlast_CBE 59.1732%-104 - C1 -3WK9 HYES_HUMAN A:[258-542] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPP--EIEEYCMEVLCKEMVTFLDKLG--LSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPF-------IPAN------PNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSL-FRASDESVLSMHKVCEAGGLFVNSPEEPSLSRM------------------------VTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLV--PQMSQHMEDWIPHLKRGH-IEDCGHWTQMDKPTEVNQILIKWL-----
34 PsiBlast_CBE 59.1532%-104 - C1 -4Y2Q HYES_HUMAN A:[258-542] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPP--EIEEYCMEVLCKEMVTFLDKLG--LSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPF-------IPAN------PNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSL-FRASDESVLSMHKVCEAGGLFVNSPEEPSLSRM------------------------VTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLV--PQMSQHMEDWIPHLKRGH-IEDCGHWTQMDKPTEVNQILIKWL-----
89 PsiBlast_CBE 59.0932%-105 - C1 -5AKH HYES_HUMAN A:[259-543] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPP--EIEEYCMEVLCKEMVTFLDKLG--LSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPF-------IPAN------PNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSL-FRASDESVLSMHKVCEAGGLFVNSPEEPSLSRM------------------------VTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLV--PQMSQHMEDWIPHLKRGH-IEDCGHWTQMDKPTEVNQILIKWL-----
84 PsiBlast_CBE 59.0432%-106 - C1 -5AKX HYES_HUMAN A:[259-543] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPP--EIEEYCMEVLCKEMVTFLDKLG--LSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPF-------IPAN------PNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSL-FRASDESVLSMHKVCEAGGLFVNSPEEPSLSRM------------------------VTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLV--PQMSQHMEDWIPHLKRGH-IEDCGHWTQMDKPTEVNQILIKWL-----
47 PsiBlast_CBE 59.0432%-105 - C1 -3WK7 HYES_HUMAN A:[258-542] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPP--EIEEYCMEVLCKEMVTFLDKLG--LSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPF-------IPAN------PNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSL-FRASDESVLSMHKVCEAGGLFVNSPEEPSLSRM------------------------VTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLV--PQMSQHMEDWIPHLKRGH-IEDCGHWTQMDKPTEVNQILIKWL-----
66 PsiBlast_CBE 59.0132%-106 - C1 -5ALT HYES_HUMAN A:[259-543] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPP--EIEEYCMEVLCKEMVTFLDKLG--LSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPF-------IPAN------PNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSL-FRASDESVLSMHKVCEAGGLFVNSPEEPSLSRM------------------------VTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLV--PQMSQHMEDWIPHLKRGH-IEDCGHWTQMDKPTEVNQILIKWL-----
33 PsiBlast_CBE 58.9632%-105 - C1 -4Y2R HYES_HUMAN A:[258-542] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPP--EIEEYCMEVLCKEMVTFLDKLG--LSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPF-------IPAN------PNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSL-FRASDESVLSMHKVCEAGGLFVNSPEEPSLSRM------------------------VTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLV--PQMSQHMEDWIPHLKRGH-IEDCGHWTQMDKPTEVNQILIKWL-----
9 PsiBlast_PDB 58.8832%-107 - C1 -4C4Z HYES_HUMAN A:[29-313] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPP--EIEEYCMEVLCKEMVTFLDKLG--LSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPF-------IPAN------PNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSL-FRASDESVLSMHKVCEAGGLFVNSPEEPSLSRM------------------------VTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLV--PQMSQHMEDWIPHLKRGH-IEDCGHWTQM