@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Rv2321c: (2016-05-09 )
MIADEIQSGLACTGYPFACDHGGVLPDIYLLGKTLGGGAVPLSAMVADREIFGVVHPGEHGSTFGGNPLAAAIGTPVVSMVVWGECQARSAKLGAHLHQRLADLIGDGAVALRGLGWWADVDIERALAIGTDMSMRLADRGVLLKDTYGAALRFAPPLVITAQEIDCAVRRFADALWEAGS

Atome Classification :

(68 SA) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------.........10........20........30.......-.40........50.....--...-----60----........70........80.....----...90.......--.100..-.------..---..--.--110-.....--...120.-------.--...-..-------130........140.....----.--.-150.......160....-.------..170.......180----
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MIADEIQSGLACTGYPFACDHGGVLPDIYLLGKTLGGG-AVPLSAMVADREIFGVVH--PGE-----HG----STFGGNPLAAAIGTPVVSMVVWGEC----QARSAKLGAHLH--QRL-AD-L------IG---DG--A--VA--LRGLG--WWADVDI-------E--RAL-AI-------GT-DMSMRLADRGVLLKDT----Y--G-AALRFAPPLVITAQEID-C------AVRRFADALWEAGS-----
122 Fugue 97.0239%-127 * C6 *2OAT OAT_HUMAN A:[36-439] -------------------------------------GPPTSDDIFEREYKYGAHNYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSRAFYNNVLGEYEEYITKLFNYHKVLPMNTGVEAGETACKLARKWGYTVKGIQKYKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALERALQDPNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGG-LYPVSAVLCDDDIMLTIK--P--GE---HG----STYGGNPLGCRVAIAALEVLEEENL----AENADKLGIILR--NEL-MK-L------PS-----DVV--TA--VRGKG--LLNAIVIKETK--------D-WD-------AW-KVCLRLRDNGLLAKPTH------G-DIIRFAPPLVIKEDELR-E------SIEIINKTILSF-------
24 PsiBlast_CBE 95.8639%-123 - C6 -5EQC ? B:[254-432] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LIVDEIQTGLCRTGRLLAADHDEVHPDILLLGKSLSAG-VVPISAVMGRADVMDVLK--PGT-----HG----STFGGNPLACAVAVEALTVLKDEKL----ADRAERLGAQFR--DCLRRE-L------YG---KV--PWIKE--IRGRG--LLNAVEV-------D--SDA-ID-------PN-DVVMKLKENGILSKPT----R--G-RVMRFIPPLVITDEEHR-D------ATTRIIKSF----------
109 HHSearch 95.5840%-117 - C6 -2OAT OAT_HUMAN A:[260-438] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLY-PVSAVLCDDDIMLTIK--PGE-----HG----STYGGNPLGCRVAIAALEVLEEENL----AENADKLGIILR--NEL-MK-L------PS---DV--V--TA--VRGKG--LLNAIVI-------K--ETKDWD-------AW-KVCLRLRDNGLLAKPT----H--G-DIIRFAPPLVIKEDELR-E------SIEIINKTILS--------
114 HHSearch 95.2839%-120 - C6 -4NOG ? A:[239-421] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LIVDEIQTGLCRTGRLLAADHDEVHPDILLLGKSLSAGVV-PISAVMGRADVMDVLK--PGT-----HG----STFGGNPLACAVAVEALTVLKDEKL----ADRAERLGAQFR--DCL-RREL------YG---KVPWI--KE--IRGRG--LLNAVEV-------D--SDA-ID-------PN-DVVMKLKENGILSKPT----R--G-RVMRFIPPLVITDEEHR-D------ATTRIIKSFLAVE------
7 PsiBlast_PDB 95.0139%-125 - C6 -5EAV ? A:[254-432] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LIVDEIQTGLCRTGRLLAADHDEVHPDILLLGKSLSAG-VVPISAVMGRADVMDVLK--PGT-----HG----STFGGNPLACAVAVEALTVLKDEKL----ADRAERLGAQFR--DCLRRE-L------YG---KV--PWIKE--IRGRG--LLNAVEV-------D--SDA-ID-------PN-DVVMKLKENGILSKPT----R--G-RVMRFIPPLVITDEEHR-D------ATTRIIKSF----------
25 PsiBlast_CBE 94.9139%-122 - C6 -5EAV ? B:[254-432] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LIVDEIQTGLCRTGRLLAADHDEVHPDILLLGKSLSAG-VVPISAVMGRADVMDVLK--PGT-----HG----STFGGNPLACAVAVEALTVLKDEKL----ADRAERLGAQFR--DCLRRE-L------YG---KV--PWIKE--IRGRG--LLNAVEV-------D--SDA-ID-------PN-DVVMKLKENGILSKPT----R--G-RVMRFIPPLVITDEEHR-D------ATTRIIKSF----------
8 PsiBlast_PDB 94.7439%-124 - C6 -5EQC ? A:[254-432] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LIVDEIQTGLCRTGRLLAADHDEVHPDILLLGKSLSAG-VVPISAVMGRADVMDVLK--PGT-----HG----STFGGNPLACAVAVEALTVLKDEKL----ADRAERLGAQFR--DCLRRE-L------YG---KV--PWIKE--IRGRG--LLNAVEV-------D--SDA-ID-------PN-DVVMKLKENGILSKPT----R--G-RVMRFIPPLVITDEEHR-D------ATTRIIKSF----------
28 PsiBlast_CBE 94.7139%-122 - C6 -4NOG ? B:[239-417] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LIVDEIQTGLCRTGRLLAADHDEVHPDILLLGKSLSAG-VVPISAVMGRADVMDVLK--PGT-----HG----STFGGNPLACAVAVEALTVLKDEKL----ADRAERLGAQFR--DCLRRE-L------YG---KV--PWIKE--IRGRG--LLNAVEV-------D--SDA-ID-------PN-DVVMKLKENGILSKPT----R--G-RVMRFIPPLVITDEEHR-D------ATTRIIKSF----------
5 PsiBlast_PDB 94.6939%-123 - C6 -4ZLV ? A:[254-432] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LIVDEIQTGLCRTGRLLAADHDEVHPDILLLGKSLSAG-VVPISAVMGRADVMDVLK--PGT-----HG----STFGGNPLACAVAVEALTVLKDEKL----ADRAERLGAQFR--DCLRRE-L------YG---KV--PWIKE--IRGRG--LLNAVEV-------D--SDA-ID-------PN-DVVMKLKENGILSKPT----R--G-RVMRFIPPLVITDEEHR-D------ATTRIIKSF----------
26 PsiBlast_CBE 94.2139%-120 - C6 -4ZWM ? B:[254-432] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LIVDEIQTGLCRTGRLLAADHDEVHPDILLLGKSLSAG-VVPISAVMGRADVMDVLK--PGT-----HG----STFGGNPLACAVAVEALTVLKDEKL----ADRAERLGAQFR--DCLRRE-L------YG---KV--PWIKE--IRGRG--LLNAVEV-------D--SDA-ID-------PN-DVVMKLKENGILSKPT----R--G-RVMRFIPPLVITDEEHR-D------ATTRIIKSF----------
6 PsiBlast_PDB 94.0339%-124 - C6 -4ZWM ? A:[254-432] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LIVDEIQTGLCRTGRLLAADHDEVHPDILLLGKSLSAG-VVPISAVMGRADVMDVLK--PGT-----HG----STFGGNPLACAVAVEALTVLKDEKL----ADRAERLGAQFR--DCLRRE-L------YG---KV--PWIKE--IRGRG--LLNAVEV-------D--SDA-ID-------PN-DVVMKLKENGILSKPT----R--G-RVMRFIPPLVITDEEHR-D------ATTRIIKSF----------
9 PsiBlast_PDB 93.9539%-123 - C6 -4NOG ? A:[239-417] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LIVDEIQTGLCRTGRLLAADHDEVHPDILLLGKSLSAG-VVPISAVMGRADVMDVLK--PGT-----HG----STFGGNPLACAVAVEALTVLKDEKL----ADRAERLGAQFR--DCLRRE-L------YG---KV--PWIKE--IRGRG--LLNAVEV-------D--SDA-ID-------PN-DVVMKLKENGILSKPT----R--G-RVMRFIPPLVITDEEHR-D------ATTRIIKSF----------
27 PsiBlast_CBE 93.2539%-124 - C6 -4ZLV ? B:[254-432] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LIVDEIQTGLCRTGRLLAADHDEVHPDILLLGKSLSAG-VVPISAVMGRADVMDVLK--PGT-----HG----STFGGNPLACAVAVEALTVLKDEKL----ADRAERLGAQFR--DCLRRE-L------YG---KV--PWIKE--IRGRG--LLNAVEV-------D--SDA-ID-------PN-DVVMKLKENGILSKPT----R--G-RVMRFIPPLVITDEEHR-D------ATTRIIKSF----------
3 PsiBlast_PDB 92.2835%-130 - C6 -3NTJ OAT_PLAF7 A:[230-414] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FVADEVQTGLGRTGKLLCTHHYGVKPDVILLGKALSGG-HYPISAILANDDVMLVLK--PGE-----HG----STYGGNPLAAAICVEALKVLINEKL----CENADKLGAPFL--QNL-KE-Q------LK---DS--K--VVREVRGKG--LLCAIEF-------K--NDL-VN-------VW-DICLKFKENGLITRSV----H--D-KTVRLTPPLCITKEQLDECTEIIVKTVKFFDDNL----------
105 HHSearch 91.8334%-122 - C6 -1Z7D - OAT_PLAYO A:[229-410] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FVADEVQTGLGRTGKLLCVHHYNVKPDVILLGKALSGGHY-PISAVLANDDIMLVIK--PGE-----HG----STYGGNPLAASICVEALNVLINEKL----CENAEKLGGPFL--ENL-KR-E------LK---DSKIV--RD--VRGKG--LLCAIEF-------K--NEL-VN-------VL-DICLKLKENGLITRDV----H--D-KTIRLTPPLCITKEQLD-E------CTEIIVKTVKFFD------
23 PsiBlast_CBE 91.7635%-129 - C6 -3NTJ OAT_PLAF7 B:[230-414] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FVADEVQTGLGRTGKLLCTHHYGVKPDVILLGKALSGG-HYPISAILANDDVMLVLK--PGE-----HG----STYGGNPLAAAICVEALKVLINEKL----CENADKLGAPFL--QNL-KE-Q------LK---DS--K--VVREVRGKG--LLCAIEF-------K--NDL-VN-------VW-DICLKFKENGLITRSV----H--D-KTVRLTPPLCITKEQLDECTEIIVKTVKFFDDNL----------
123 Fugue 91.5232%-121 - C6 -4UOX PAT_ECOLI A:[7-459] SASALACSAHALNLIEKRTLDHEEMKALNREVIEYFKEHVNPGFLEYRKSVTAGGDYGAVEWQAGSLNTLVDTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQELLDPLRAMLAKTLAALTPGKLKYSFFCNSGTESVEAALKLAKAYQSPRGKFTFIATSGAFHGKSLGALSATAKSTFRKPFMPLLPGFRHVPFGNIEAMRTALNECKKTGDDVAAVILEPIQGEGGVILPPPGYLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGG-VMPIGATIATEEVFSVLFDNPFL-----HT----TTFGGNPLACAAALATINVLLEQNL----PAQAEQKGDMLL--DGF-RQ-L------AREYPDL--V--QE--ARGKG--MLMAIEF-------V--D-N-EI-------GY-NFASEMFRQRVLVAGT----LNNA-KTIRIEPPLTLTIEQCE-L------VIKAARKALAAMRVSVEEA
22 PsiBlast_CBE 91.3335%-128 - C6 -3NTJ OAT_PLAF7 C:[230-414] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FVADEVQTGLGRTGKLLCTHHYGVKPDVILLGKALSGG-HYPISAILANDDVMLVLK--PGE-----HG----STYGGNPLAAAICVEALKVLINEKL----CENADKLGAPFL--QNL-KE-Q------LK---DS--K--VVREVRGKG--LLCAIEF-------K--NDL-VN-------VW-DICLKFKENGLITRSV----H--D-KTVRLTPPLCITKEQLDECTEIIVKTVKFFDDNL----------
21 PsiBlast_CBE 91.3035%-128 - C6 -3NTJ OAT_PLAF7 D:[230-414] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FVADEVQTGLGRTGKLLCTHHYGVKPDVILLGKALSGG-HYPISAILANDDVMLVLK--PGE-----HG----STYGGNPLAAAICVEALKVLINEKL----CENADKLGAPFL--QNL-KE-Q------LK---DS--K--VVREVRGKG--LLCAIEF-------K--NDL-VN-------VW-DICLKFKENGLITRSV----H--D-KTVRLTPPLCITKEQLDECTEIIVKTVKFFDDNL----------
2 PsiBlast_PDB 90.6935%-130 - C6 -3LG0 - OAT_PLAFD A:[230-414] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FVADEVQTGLGRTGKLLCTHHYGVKPDVILLGKALSGG-HYPISAILANDDVMLVLK--PGE-----HG----STYGGNPLAAAICVEALKVLINEKL----CENADKLGAPFL--QNL-KE-Q------LK---DS--K--VVREVRGKG--LLCAIEF-------K--NDL-VN-------VW-DICLKFKENGLITRSV----H--D-KTVRLTPPLCITKEQLDECTEIIVKTVKFFDDNL----------
10 PsiBlast_PDB 90.6440%-115 - C6 -2BYJ OAT_HUMAN A:[260-430] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGG-LYPVSAVLCDDDIMLTIK--PGE-----HG----STYGGNPLGCRVAIAALEVLEEENL----AENADKLGIILR--NEL-MK-L------PS---DV--V--TA--VRGKG--LLNAIVI-------K--ETK-DW-------DAWKVCLRLRDNGLLAKPT----H--G-DIIRFAPPLVIKEDELR-E------SIE----------------
31 PsiBlast_CBE 90.0740%-115 - C6 -2OAT OAT_HUMAN C:[260-430] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGG-LYPVSAVLCDDDIMLTIK--PGE-----HG----STYGGNPLGCRVAIAALEVLEEENL----AENADKLGIILR--NEL-MK-L------PS---DV--V--TA--VRGKG--LLNAIVI-------K--ETK-DW-------DAWKVCLRLRDNGLLAKPT----H--G-DIIRFAPPLVIKEDELR-E------SIE----------------
12 PsiBlast_PDB 90.0640%-115 - C6 -2OAT OAT_HUMAN A:[260-430] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGG-LYPVSAVLCDDDIMLTIK--PGE-----HG----STYGGNPLGCRVAIAALEVLEEENL----AENADKLGIILR--NEL-MK-L------PS---DV--V--TA--VRGKG--LLNAIVI-------K--ETK-DW-------DAWKVCLRLRDNGLLAKPT----H--G-DIIRFAPPLVIKEDELR-E------SIE----------------
40 PsiBlast_CBE 89.8440%-114 - C6 -2BYL OAT_HUMAN B:[260-430] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGG-LYPVSAVLCDDDIMLTIK--PGE-----HF----STYGGNPLGCRVAIAALEVLEEENL----AENADKLGIILR--NEL-MK-L------PS---DV--V--TA--VRGKG--LLNAIVI-------K--ETK-DW-------DAWKVCLRLRDNGLLAKPT----H--G-DIIRFAPPLVIKEDELR-E------SIE----------------
30 PsiBlast_CBE 89.7840%-114 - C6 -2BYJ OAT_HUMAN B:[260-430] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGG-LYPVSAVLCDDDIMLTIK--PGE-----HG----STYGGNPLGCRVAIAALEVLEEENL----AENADKLGIILR--NEL-MK-L------PS---DV--V--TA--VRGKG--LLNAIVI-------K--ETK-DW-------DAWKVCLRLRDNGLLAKPT----H--G-DIIRFAPPLVIKEDELR-E------SIE----------------
15 PsiBlast_PDB 89.7640%-111 - C6 -2BYL OAT_HUMAN A:[260-430] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGG-LYPVSAVLCDDDIMLTIK--PGE-----HF----STYGGNPLGCRVAIAALEVLEEENL----AENADKLGIILR--NEL-MK-L------PS---DV--V--TA--VRGKG--LLNAIVI-------K--ETK-DW-------DAWKVCLRLRDNGLLAKPT----H--G-DIIRFAPPLVIKEDELR-E------SIE----------------
32 PsiBlast_CBE 89.7040%-112 - C6 -2OAT OAT_HUMAN B:[260-430] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGG-LYPVSAVLCDDDIMLTIK--PGE-----HG----STYGGNPLGCRVAIAALEVLEEENL----AENADKLGIILR--NEL-MK-L------PS---DV--V--TA--VRGKG--LLNAIVI-------K--ETK-DW-------DAWKVCLRLRDNGLLAKPT----H--G-DIIRFAPPLVIKEDELR-E------SIE----------------
29 PsiBlast_CBE 89.4240%-115 - C6 -2BYJ OAT_HUMAN C:[260-430] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGG-LYPVSAVLCDDDIMLTIK--PGE-----HG----STYGGNPLGCRVAIAALEVLEEENL----AENADKLGIILR--NEL-MK-L------PS---DV--V--TA--VRGKG--LLNAIVI-------K--ETK-DW-------DAWKVCLRLRDNGLLAKPT----H--G-DIIRFAPPLVIKEDELR-E------SIE----------------
11 PsiBlast_PDB 89.2740%-116 - C6 -1OAT OAT_HUMAN A:[260-430] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGG-LYPVSAVLCDDDIMLTIK--PGE-----HG----STYGGNPLGCRVAIAALEVLEEENL----AENADKLGIILR--NEL-MK-L------PS---DV--V--TA--VRGKG--LLNAIVI-------K--ETK-DW-------DAWKVCLRLRDNGLLAKPT----H--G-DIIRFAPPLVIKEDELR-E------SIE----------------
39 PsiBlast_CBE 89.2240%-116 - C6 -2BYL OAT_HUMAN C:[260-430] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGG-LYPVSAVLCDDDIMLTIK--PGE-----HF----STYGGNPLGCRVAIAALEVLEEENL----AENADKLGIILR--NEL-MK-L------PS---DV--V--TA--VRGKG--LLNAIVI-------K--ETK-DW-------DAWKVCLRLRDNGLLAKPT----H--G-DIIRFAPPLVIKEDELR-E------SIE----------------
33 PsiBlast_CBE 88.9040%-115 - C6 -1OAT OAT_HUMAN C:[260-430] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGG-LYPVSAVLCDDDIMLTIK--PGE-----HG----STYGGNPLGCRVAIAALEVLEEENL----AENADKLGIILR--NEL-MK-L------PS---DV--V--TA--VRGKG--LLNAIVI-------K--ETK-DW-------DAWKVCLRLRDNGLLAKPT----H--G-DIIRFAPPLVIKEDELR-E------SIE----------------
34 PsiBlast_CBE 88.6440%-113 - C6 -1OAT OAT_HUMAN B:[260-430] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGG-LYPVSAVLCDDDIMLTIK--PGE-----HG----STYGGNPLGCRVAIAALEVLEEENL----AENADKLGIILR--NEL-MK-L------PS---DV--V--TA--VRGKG--LLNAIVI-------K--ETK-DW-------DAWKVCLRLRDNGLLAKPT----H--G-DIIRFAPPLVIKEDELR-E------SIE----------------
96 PsiBlast_CBE 87.4833%-121 - C6 -1D7U DGDA_BURCE A:[240-432] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LILDEAQTGVGRTGTMFACQRDGVTPDILTLSKTLGAG--LPLAAIVTSAAIEERAH----E-----LGYLFYTTHVSDPLPAAVGLRVLDVVQRDGL----VARANVMGDRLR--RGL-LD-LMERFDCIG---D----------VRGRG--LLLGVEIVKDRRTKE--PAD-GL-------GA-KITRECMNLGLSMNIVQLPGM--G-GVFRIAPPLTVSEDEID-L------GLSLLGQAIERA-------
97 PsiBlast_CBE 87.2733%-121 - C6 -1D7S DGDA_BURCE A:[240-432] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LILDEAQTGVGRTGTMFACQRDGVTPDILTLSKTLGAG--LPLAAIVTSAAIEERAH----E-----LGYLFYTTHVSDPLPAAVGLRVLDVVQRDGL----VARANVMGDRLR--RGL-LD-LMERFDCIG---D----------VRGRG--LLLGVEIVKDRRTKE--PAD-GL-------GA-KITRECMNLGLSMNIVQLPGM--G-GVFRIAPPLTVSEDEID-L------GLSLLGQAIERA-------
99 PsiBlast_CBE 86.8533%-122 - C6 -1Z3Z DGDA_BURCE A:[238-430] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LILDEAQTGVGRTGTMFACQRDGVTPDILTLSKTLGAG--LPLAAIVTSAAIEERAH----E-----LGYLFYTTHVSDPLPAAVGLRVLDVVQRDGL----VARANVMGDRLR--RGL-LD-LMERFDCIG---D----------VRGRG--LLLGVEIVKDRRTKE--PAD-GL-------GA-KITRECMNLGLSMNIVQLPGM--G-GVFRIAPPLTVSEDEID-L------GLSLLGQAIERA-------
95 PsiBlast_CBE 86.4033%-117 - C6 -1D7V DGDA_BURCE A:[240-432] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LILDEAQTGVGRTGTMFACQRDGVTPDILTLSKTLGAG--LPLAAIVTSAAIEERAH----E-----LGYLFYTTHVSDPLPAAVGLRVLDVVQRDGL----VARANVMGDRLR--RGL-LD-LMERFDCIG---D----------VRGRG--LLLGVEIVKDRRTKE--PAD-GL-------GA-KITRECMNLGLSMNIVQLPGM--G-GVFRIAPPLTVSEDEID-L------GLSLLGQAIERA-------
100 PsiBlast_CBE 85.8533%-125 - C6 -2DKB DGDA_BURCE A:[240-432] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LILDEAQTGVGRTGTMFACQRDGVTPDILTLSKTLGAG--LPLAAIVTSAAIEERAH----E-----LGYLFYTTHVSDPLPAAVGLRVLDVVQRDGL----VARANVMGDRLR--RGL-LD-LMERFDCIG---D----------VRGRG--LLLGVEIVKDRRTKE--PAD-GL-------GA-KITRECMNLGLSMNIVQLPGM--G-GVFRIAPPLTVSEDEID-L------GLSLLGQAIERA-------
107 HHSearch 83.7033%-124 - C6 -4JF1 ARGD_SALTY A:[238-419] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LVFDEVQCGMGRTGDLFAYMHYGVTPDILTSAKALGGG-F-PVSAMLTTQEIASAF-----------------STYGGNPLACAVAGATFDIINTPEV----LQGIHTKRQQFV--QHL-QA-I------DE---QFDIF--SD--IRGMG--LLIGAEL-------K--PKYKGR-------AR-DFLYAGAEAGVMVLNA----G--A-DVMRFAPSLVVEEADIH-E------GMQRFAQAVGKVV------
121 HHSearch 83.1131%-132 - C6 -2EO5 ? A:[249-418] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LVDDEVQMGLGRTGKLFAIENFNTVPDVITLAKALGGGIM-PIGATIFRKDLD--FK-----------------TFGGNALACAIGSKVIDIVK--DL----LPHVNEIGKIFA--EEL-QG-L------A-----------DD--VRGIG--LAWGLEY-------N--EKK--V-------RD-RIIGESFKRGLLLLPA----G--R-SAIRVIPPLVISEEEAK-Q------GLDILKKVIKVV-------
66 PsiBlast_CBE 83.0833%-129 - C6 -2PB0 ARGD_SALTY B:[238-415] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LVFDEVQCGMGRTGDLFAYMHYGVTPDILTSAKALGGG--FPVSAMLTTQEIASAFH--VGS-----HG----STYGGNPLACAVAGAAFDIINTPEVLQGIHTKRQQFVQHLQAIDEQ-FD-I------FS---D----------IRGMG--LLIGAEL-------KP-KYK-GR-------AR-DFLYAGAEAGVMVLNA----G--A-DVMRFAPSLVVEEADIH-E------GMQRFAQAV----------
117 HHSearch 82.7031%-112 - C6 -3DXV ACLR_ACHOB A:[238-426] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------VVCDEVKVGLARSGRLHCFEHEGFVPDILVLGKGLGGG-L-PLSAVIAPAEILDCAS--A-F-----AM----QTLHGNPISAAAGLAVLETIDRDDL----PAMAERKGRLLR--DGL-SE-L------AK---RHPLI--GD--IRGRG--LACGMEL-------V--CDR-QSREPARAETA-KLIYRAYQLGLVVYYVGM--N--G-NVLEFTPPLTITETDIH-K------ALDLLDRAFSELS------
60 PsiBlast_CBE 82.1533%-127 - C6 -4JEY ARGD_SALTY B:[238-415] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LVFDEVQCGMGRTGDLFAYMHYGVTPDILTSAKALGGG--FPVSAMLTTQEIASAFH--VGS-----HG----STYGGNPLACAVAGATFDIINTPEVLQGIHTKRQQFVQHLQAIDEQ-FD-I------FS---D----------IRGMG--LLIGAEL-------KP-KYK-GR-------AR-DFLYAGAEAGVMVLNA----G--A-DVMRFAPSLVVEEADIH-E------GMQRFAQAV----------
67 PsiBlast_CBE 82.1133%-133 - C6 -2PB0 ARGD_SALTY A:[238-415] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LVFDEVQCGMGRTGDLFAYMHYGVTPDILTSAKALGGG--FPVSAMLTTQEIASAF------------G----STYGGNPLACAVAGAAFDIINTPEVLQGIHTKRQQFVQHLQAIDEQ-FD-I------FS---D----------IRGMG--LLIGAEL-------KP-KYK-GR-------AR-DFLYAGAEAGVMVLNA----G--A-DVMRFAPSLVVEEADIH-E------GMQRFAQAV----------
52 PsiBlast_CBE 82.0933%-128 - C6 -4JF1 ARGD_SALTY B:[238-415] ---------------------------------------------------------------