@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Rv2445c: (2016-05-10 )
MTERTLVLIKPDGIERQLIGEIISRIERKGLTIAALQLRTVSAELASQHYAEHEGKPFFGSLLEFITSGPVVAAIVEGTRAIAAVRQLAGGTDPVQAAAPGTIRGDFALETQFNLVHGSDSAESAQREIALWFPGA

Atome Classification :

(99 SA) -.........10........20........30........40.........50........60........70........80........90.......---.100.......110---.......120.......130....--------------
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) -MTERTLVLIKPDGIERQLIGEIISRIERKGLTIAALQLRT-VSAELASQHYAEHEGKPFFGSLLEFITSGPVVAAIVEGTRAIAAVRQLAGGTDPVQAA---APGTIRGDFALETQ---FNLVHGSDSAESAQREIALWFPGA--------------
113 HHSearch 96.9799%-118 - C7 -4ANE NDK_MYCTU A:[2-136] --TERTLVLIKPDGIERQLIGEIISRIERKGLTIAALQLRT-VSAELASQHYAEHEGKPFFGSLLEFITSGPVVAAIVEGTNAIAAVRQLAGGTDPVQAA---APGTIRGDFALETQ---FNLVHGSDSAESAQREIALWFPGA--------------
4 PsiBlast_PDB 96.9699%-118 - C7 -4ANE NDK_MYCTU A:[2-136] --TERTLVLIKPDGIERQLIGEIISRIERKGLTIAALQLRT-VSAELASQHYAEHEGKPFFGSLLEFITSGPVVAAIVEGTNAIAAVRQLAGGTDPVQAA---APGTIRGDFALETQ---FNLVHGSDSAESAQREIALWFPGA--------------
1 PsiBlast_PDB 96.56100%-124 - C7 -1K44 - NDK_MYCTU A:[2-136] --TERTLVLIKPDGIERQLIGEIISRIERKGLTIAALQLRT-VSAELASQHYAEHEGKPFFGSLLEFITSGPVVAAIVEGTRAIAAVRQLAGGTDPVQAA---APGTIRGDFALETQ---FNLVHGSDSAESAQREIALWFPGA--------------
3 PsiBlast_PDB 95.2799%-124 - C7 -4AND - NDK_MYCTU A:[2-136] --TERTLVLIKPDGIERQLIGEIISRIERKGLTIAALQLRT-VSAELASQHYAEHEGKPFFGSLLEFITSGPVVAAIVEGTRAIAAVRQLAGGTNPVQAA---APGTIRGDFALETQ---FNLVHGSDSAESAQREIALWFPGA--------------
22 PsiBlast_CBE 93.8099%-121 - C7 -4ANE NDK_MYCTU D:[2-136] --TERTLVLIKPDGIERQLIGEIISRIERKGLTIAALQLRT-VSAELASQHYAEHE----FGSLLEFITSGPVVAAIVEGTNAIAAVRQLAGGTDPVQAA---APGTIRGDFALETQ---FNLVHGSDSAESAQREIALWFPGA--------------
2 PsiBlast_PDB 92.4399%-123 - C7 -4ANC - NDK_MYCTU A:[2-136] --TERTLVLIKPDGIERQLIGEIISRIERKGLTIAALQLRT-VSAELASQHYAEHEGKPFFGSLLEFITSGPVVAAIVEGTRAIAAVRQLAGGTNPVQAA---APGTIRGDFALETQ---FNLVHGSDSAESAQREIALWFPGA--------------
21 PsiBlast_CBE 90.3799%-119 - C7 -4ANE NDK_MYCTU F:[2-136] --TERTLVLIKPDGIERQLIGEIISRIERKGLTIAALQLRT-VSAELASQHYAEH--------LLEFITSGPVVAAIVEGTNAIAAVRQLAGGTDPVQAA---APGTIRGDFALETQ---FNLVHGSDSAESAQREIALWFPGA--------------
5 PsiBlast_PDB 85.0159%-119 - C7 -3VVT - ? A:[2-131] ---ERTFVMIKPDGVQRGLIGEIISRFERKGLKIVAMKMMR-ISREMAEKHYAEHREKPFFSALVDYITSGPVVAMVLEGKNAVEVVRKMVGATNP-KEA---APGTIRGDFGLDVG---KNVIHASDSPESAEREISLFF-----------------
39 PsiBlast_CBE 84.9055%-116 - C7 -3Q8U NDK_STAAC F:[2-131] ---ERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQ-VPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSE-A---SPGSIRGDLGLTVG---RNIIHGSDSLESAEREINLWF-----------------
41 PsiBlast_CBE 84.7355%-115 - C7 -3Q8U NDK_STAAC D:[2-131] ---ERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQ-VPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSE-A---SPGSIRGDLGLTVG---RNIIHGSDSLESAEREINLWF-----------------
26 PsiBlast_CBE 84.7056%-116 - C7 -2DXF NDK_PYRHO B:[7-140] --TERTLVIIKPDAVVRGLIGEIISRFEKKGLKIVGMKMIW-IDRELAEKHYEEHREKPFFKALIDYITKTPVVVMVLEGRYAVEVVRKMAGATDP-KDA---APGTIRGDFGLEVSDAICNVIHASDSKESAEREISLFF-----------------
46 PsiBlast_CBE 84.4855%-114 - C7 -3Q86 NDK_STAAC B:[2-131] ---ERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQ-VPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSE-A---SPGSIRGDLGLTVG---RNIIHGSDSLESAEREINLWF-----------------
28 PsiBlast_CBE 84.4656%-117 - C7 -2DXD NDK_PYRHO B:[7-140] --TERTLVIIKPDAVVRGLIGEIISRFEKKGLKIVGMKMIW-IDRELAEKHYEEHREKPFFKALIDYITKTPVVVMVLEGRYAVEVVRKMAGATDP-KDA---APGTIRGDFGLEVSDAICNVIHASDSKESAEREISLFF-----------------
25 PsiBlast_CBE 84.3956%-116 - C7 -2DY9 NDK_PYRHO B:[7-140] --TERTLVIIKPDAVVRGLIGEIISRFEKKGLKIVGMKMIW-IDRELAEKHYEEHREKPFFKALIDYITKTPVVVMVLEGRYAVEVVRKMAGATDP-KDA---APGTIRGDFGLEVSDAICNVIHASDSKESAEREISLFF-----------------
8 PsiBlast_PDB 84.3759%-116 - C7 -1WKK NDK_THET8 A:[2-131] ---ERTFVMIKPDGVRRGLVGEILARFERKGFRIAALKLMQ-ISQELAERHYAEHREKPFFPGLVRFITSGPVVAMVLEGPGVVAEVRKMMGATHP-KDA---LPGTIRGDFATTID---ENVIHGSATLEDAQREIALFF-----------------
15 PsiBlast_PDB 84.3456%-113 - C7 -2DYA NDK_PYRHO A:[7-140] --TERTLVIIKPDAVVRGLIGEIISRFEKKGLKIVGMKMIW-IDRELAEKHYEEHREKPFFKALIDYITKTPVVVMVLEGRYAVEVVRKMAGATDP-KDA---APGTIRGDFGLEVSDAICNVIHASDSKESAEREISLFF-----------------
24 PsiBlast_CBE 84.3256%-117 - C7 -2DYA NDK_PYRHO B:[7-140] --TERTLVIIKPDAVVRGLIGEIISRFEKKGLKIVGMKMIW-IDRELAEKHYEEHREKPFFKALIDYITKTPVVVMVLEGRYAVEVVRKMAGATDP-KDA---APGTIRGDFGLEVSDAICNVIHASDSKESAEREISLFF-----------------
10 PsiBlast_PDB 84.2856%-120 - C7 -2CWK - NDK_PYRHO A:[7-140] --TERTLVIIKPDAVVRGLIGEIISRFEKKGLKIVGMKMIW-IDRELAEKHYEEHREKPFFKALIDYITKTPVVVMVLEGRYAVEVVRKMAGATDP-KDA---APGTIRGDFGLEVSDAICNVIHASDSKESAEREISLFF-----------------
31 PsiBlast_CBE 84.2655%-119 - C7 -3Q8Y NDK_STAAC F:[2-131] ---ERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQ-VPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSE-A---SPGSIRGDLGLTVG---RNIIHGSDSLESAEREINLWF-----------------
16 PsiBlast_PDB 84.2155%-115 - C7 -3Q83 - NDK_STAAC A:[2-131] ---ERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQ-VPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSE-A---SPGSIRGDLGLTVG---RNIIHGSDSLESAEREINLWF-----------------
9 PsiBlast_PDB 84.1359%-119 - C7 -1WKL NDK_THET8 A:[2-131] ---ERTFVMIKPDGVRRGLVGEILARFERKGFRIAALKLMQ-ISQELAERHYAEHREKPFFPGLVRFITSGPVVAMVLEGPGVVAEVRKMMGATHP-KDA---LPGTIRGDFATTID---ENVIHGSATLEDAQREIALFF-----------------
13 PsiBlast_PDB 83.9156%-119 - C7 -2DXF NDK_PYRHO A:[7-140] --TERTLVIIKPDAVVRGLIGEIISRFEKKGLKIVGMKMIW-IDRELAEKHYEEHREKPFFKALIDYITKTPVVVMVLEGRYAVEVVRKMAGATDP-KDA---APGTIRGDFGLEVSDAICNVIHASDSKESAEREISLFF-----------------
30 PsiBlast_CBE 83.8955%-116 - C7 -3Q8Y NDK_STAAC G:[2-131] ---ERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQ-VPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSE-A---SPGSIRGDLGLTVG---RNIIHGSDSLESAEREINLWF-----------------
11 PsiBlast_PDB 83.7956%-118 - C7 -2DXD NDK_PYRHO A:[7-140] --TERTLVIIKPDAVVRGLIGEIISRFEKKGLKIVGMKMIW-IDRELAEKHYEEHREKPFFKALIDYITKTPVVVMVLEGRYAVEVVRKMAGATDP-KDA---APGTIRGDFGLEVSDAICNVIHASDSKESAEREISLFF-----------------
19 PsiBlast_PDB 83.5555%-116 - C7 -3Q8U NDK_STAAC A:[2-131] ---ERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQ-VPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSE-A---SPGSIRGDLGLTVG---RNIIHGSDSLESAEREINLWF-----------------
40 PsiBlast_CBE 83.5255%-114 - C7 -3Q8U NDK_STAAC E:[2-131] ---ERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQ-VPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSE-A---SPGSIRGDLGLTVG---RNIIHGSDSLESAEREINLWF-----------------
12 PsiBlast_PDB 83.4756%-116 - C7 -2DXE NDK_PYRHO A:[7-140] --TERTLVIIKPDAVVRGLIGEIISRFEKKGLKIVGMKMIW-IDRELAEKHYEEHREKPFFKALIDYITKTPVVVMVLEGRYAVEVVRKMAGATDP-KDA---APGTIRGDFGLEVSDAICNVIHASDSKESAEREISLFF-----------------
37 PsiBlast_CBE 83.4055%-121 - C7 -3Q8V NDK_STAAC D:[2-131] ---ERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQ-VPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSE-A---SPGSIRGDLGLTVG---RNIIHGSDSLESAEREINLWF-----------------
35 PsiBlast_CBE 83.2655%-118 - C7 -3Q8Y NDK_STAAC B:[2-131] ---ERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQ-VPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSE-A---SPGSIRGDLGLTVG---RNIIHGSDSLESAEREINLWF-----------------
42 PsiBlast_CBE 83.1755%-115 - C7 -3Q8U NDK_STAAC C:[2-131] ---ERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQ-VPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSE-A---SPGSIRGDLGLTVG---RNIIHGSDSLESAEREINLWF-----------------
45 PsiBlast_CBE 83.1355%-119 - C7 -3Q89 NDK_STAAC B:[2-131] ---ERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQ-VPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSE-A---SPGSIRGDLGLTVG---RNIIHGSDSLESAEREINLWF-----------------
14 PsiBlast_PDB 83.1356%-115 - C7 -2DY9 NDK_PYRHO A:[7-140] --TERTLVIIKPDAVVRGLIGEIISRFEKKGLKIVGMKMIW-IDRELAEKHYEEHREKPFFKALIDYITKTPVVVMVLEGRYAVEVVRKMAGATDP-KDA---APGTIRGDFGLEVSDAICNVIHASDSKESAEREISLFF-----------------
33 PsiBlast_CBE 83.1155%-114 - C7 -3Q8Y NDK_STAAC D:[2-131] ---ERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQ-VPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSE-A---SPGSIRGDLGLTVG---RNIIHGSDSLESAEREINLWF-----------------
38 PsiBlast_CBE 82.9455%-118 - C7 -3Q8V NDK_STAAC B:[2-131] ---ERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQ-VPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSE-A---SPGSIRGDLGLTVG---RNIIHGSDSLESAEREINLWF-----------------
44 PsiBlast_CBE 82.8955%-117 - C7 -3Q89 NDK_STAAC E:[2-131] ---ERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQ-VPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSE-A---SPGSIRGDLGLTVG---RNIIHGSDSLESAEREINLWF-----------------
36 PsiBlast_CBE 82.6255%-115 - C7 -3Q8Y NDK_STAAC A:[2-131] ---ERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQ-VPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSE-A---SPGSIRGDLGLTVG---RNIIHGSDSLESAEREINLWF-----------------
29 PsiBlast_CBE 82.5755%-118 - C7 -3Q8Y NDK_STAAC H:[2-131] ---ERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQ-VPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSE-A---SPGSIRGDLGLTVG---RNIIHGSDSLESAEREINLWF-----------------
20 PsiBlast_PDB 82.4155%-114 - C7 -3Q8V NDK_STAAC A:[2-131] ---ERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQ-VPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSE-A---SPGSIRGDLGLTVG---RNIIHGSDSLESAEREINLWF-----------------
43 PsiBlast_CBE 82.3755%-115 - C7 -3Q8U NDK_STAAC B:[2-131] ---ERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQ-VPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSE-A---SPGSIRGDLGLTVG---RNIIHGSDSLESAEREINLWF-----------------
17 PsiBlast_PDB 82.2355%-111 - C7 -3Q86 NDK_STAAC A:[2-131] ---ERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQ-VPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSE-A---SPGSIRGDLGLTVG---RNIIHGSDSLESAEREINLWF-----------------
23 PsiBlast_CBE 81.4659%-120 - C7 -1WKL NDK_THET8 B:[2-131] ---ERTFVMIKPDGVRRGLVGEILARFERKGFRIAALKLMQ-ISQELAERHYAEHREKPFFPGLVRFITSGPVVAMVLEGPGVVAEVRKMMGATHP-KDA---LPGTIRGDFATTID---ENVIHGSATLEDAQREIALFF-----------------
32 PsiBlast_CBE 81.4255%-116 - C7 -3Q8Y NDK_STAAC E:[2-131] ---ERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQ-VPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSE-A---SPGSIRGDLGLTVG---RNIIHGSDSLESAEREINLWF-----------------
117 HHSearch 81.4151%-105 - C7 -1NHK NDK_MYXXA R:[2-134] --IERTLSIIKPDGLEKGVIGKIISRFEEKGLKPVAIRLQH-LSQAQAEGFYAVHKARPFFKDLVQFMISGPVVLMVLEGENAVLANRDIMGATNPAQ-A---AEGTIRKDFATSID---KNTVHGSDSLENAKIEIAYFFRE---------------
75 PsiBlast_CBE 80.1553%-110 - C7 -1ZS6 NDK3_HUMAN D:[22-151] ---ERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQ-ASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPAD-A---PPGTIRGDFCIEVG---KNLIHGSDSVESARREIALWF-----------------
77 PsiBlast_CBE 79.6153%-117 - C7 -1ZS6 NDK3_HUMAN A:[22-151] ---ERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQ-ASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPAD-A---PPGTIRGDFCIEVG---KNLIHGSDSVESARREIALWF-----------------
60 PsiBlast_CBE 79.3354%-118 - C7 -1HIY NDKC_DICDI B:[9-138] ---ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLV-PTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPL-AS---APGSIRGDFGVDVG---RNIIHGSDSVESANREIALWF-----------------
102 Fugue 79.3251%-112 - C7 -1NDP NDKC_DICDI A:[6-155] VNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLV-PTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASA----PGSIRGDFGVDVG---RNIIHGSDSVESANREIALWFKPEELLTEVKPNPNLYE
56 PsiBlast_CBE 79.0854%-114 - C7 -1KDN NDKC_DICDI C:[9-138] ---ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLV-PTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPL-AS---APGSIRGDFGVDVG---RNIIHGSDSVESANREIALWF-----------------
128 HHSearch 79.0047%-111 - C7 -4FKX ? A:[11-143] --SERTFIAVKPDGVQRNLVGEIIKRFENKGYKLVGLKLLQ-PTEEQAKQHYIDLASKPFYSGLVSYFSSGPIVGMVWEGLGVVKGGRVLLGATNPAD-S---LPGTIRGDFAVDVG---RNVCHGSDSVESAKREIAFWFKA---------------
89 PsiBlast_CBE 78.9653%-121 - C7 -3FKB NDKC_DICDI D:[9-138] ---ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLV-PTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPL-AS---APGSIRGDFGVDVG---RNIIGGSDSVESANREIALWF-----------------
54 PsiBlast_CBE 78.9554%-114 - C7 -1NDP NDKC_DICDI A:[9-138] ---ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLV-PTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPL-AS---APGSIRGDFGVDVG---RNIIHGSDSVESANREIALWF-----------------
76 PsiBlast_CBE 78.8953%-112 - C7 -1ZS6 NDK3_HUMAN B:[22-151] ---ERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQ-ASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPAD-A---PPGTIRGDFCIEVG---KNLIHGSDSVESARREIALWF-----------------
96 PsiBlast_CBE 78.7953%-117 - C7 -1F3F NDKC_DICDI C:[9-138] ---ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLV-PTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPL-AS---APGSIRGDFGVDVG---RNIIGGSDSVESANREIALWF-----------------
47 PsiBlast_CBE 78.6854%-113 - C7 -2BEF NDKC_DICDI C:[9-138] ---ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLV-PTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPL-AS---APGSIRGDFGVDVG---RNIIHGSDSVESANREIALWF-----------------
58 PsiBlast_CBE 78.5254%-113 - C7 -1KDN NDKC_DICDI A:[9-138] ---ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLV-PTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPL-AS---APGSIRGDFGVDVG---RNIIHGSDSVESANREIALWF-----------------
124 HHSearch 78.2847%-109 - C7 -3EVO NDK_MIMIV A:[6-138] --LQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEGTDAISKIRRLQGNTNPLA-S---APGTIRGDLANDIR---ENLIHASDSEDSAVDEISIWFP----------------
99 PsiBlast_CBE 78.0053%-113 - C7 -1B4S NDKC_DICDI C:[9-138] ---ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLV-PTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPL-AS---APGSIRGDFGVDVG---RNIIGGSDSVESANREIALWF-----------------
67 PsiBlast_CBE 77.9154%-116 - C7 -1BUX NDKC_DICDI A:[9-138] ---ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLV-PTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPL-AS---APGSIRGDFGVDVG---RNIIHGSDSVESANREIALWF-----------------
55 PsiBlast_CBE 77.8854%-118 - C7 -1NDC NDKC_DICDI A:[9-138] ---ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLV-PTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPL-AS---APGSIRGDFGVDVG---RNIIHGSDSVESANREIALWF-----------------
53 PsiBlast_CBE 77.6754%-116 - C7 -1NDP NDKC_DICDI B:[9-138] ---ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLV-PTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPL-AS---APGSIRGDFGVDVG---RNIIHGSDSVESANREIALWF-----------------
93 PsiBlast_CBE 77.6553%-117 - C7 -1MN9 NDKC_DICDI C:[9-138] ---ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLV-PTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPL-AS---APGSIRGDFGVDVG---RNIIGGSDSVESANREIALWF-----------------
57 PsiBlast_CBE 77.6454%-115 - C7 -1KDN NDKC_DICDI B:[9-138] ---ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLV-PTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPL-AS---APGSIRGDFGVDVG---RNIIHGSDSVESANREIALWF-----------------
61 PsiBlast_CBE 77.5754%-113 - C7 -1HIY NDKC_DICDI A:[9-138] ---ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLV-PTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPL-AS---APGSIRGDFGVDVG---RNIIHGSDSVESANREIALWF-----------------
88 PsiBlast_CBE 77.4553%-117 - C7 -3FKB NDKC_DICDI E:[9-138] ---ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLV-PTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPL-AS---APGSIRGDFGVDVG---RNIIGGSDSVESANREIALWF-----------------
92 PsiBlast_CBE 77.4153%-116 - C7 -3FKB NDKC_DICDI A:[9-138] ---ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLV-PTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPL-AS---APGSIRGDFGVDVG---RNIIGGSDSVESANREIALWF-----------------
66 PsiBlast_CBE 77.3154%-117 - C7 -1BUX NDKC_DICDI B:[9-138] ---ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLV-PTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPL-AS---APGSIRGDFGVDVG---RNIIHGSDSVESANREIALWF-----------------
87 PsiBlast_CBE 77.3053%-116 - C7 -3FKB NDKC_DICDI F:[9-138] ---ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLV-PTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPL-AS---APGSIRGDFGVDVG---RNIIGGSDSVESANREIALWF-----------------
90 PsiBlast_CBE 77.2953%-120 - C7 -3FKB NDKC_DICDI C:[9-138] ---ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLV-PTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPL-AS---APGSIRGDFGVDVG---RNIIGGSDSVESANREIALWF-----------------
59 PsiBlast_CBE 77.2454%-117 - C7 -1HIY NDKC_DICDI C:[9-138] ---ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLV-PTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPL-AS---APGSIRGDFGVDVG---RNIIHGSDSVESANREIALWF-----------------
80 PsiBlast_CBE 77.2153%-114 - C7 -1LWX NDKC_DICDI A:[9-138] ---ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLV-PTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPL-AS---APGSIRGDFGVDVG---RAIIHGSDSVESANREIALWF-----------------
94 PsiBlast_CBE 77.1953%-116 - C7 -1MN9 NDKC_DICDI B:[9-138] ---ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLV-PTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPL-AS---APGSIRGDFGVDVG---RNIIGGSDSVESANREIALWF-----------------
49 PsiBlast_CBE 77.1754%-109 - C7 -2BEF NDKC_DICDI A:[9-138] ---ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLV-PTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPL-AS---APGSIRGDFGVDVG---RNIIHGSDSVESANREIALWF-----------------
95 PsiBlast_CBE 77.1653%-117 - C7 -1MN9 NDKC_DICDI A:[9-138] ---ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLV-PTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPL-AS---APGSIRGDFGVDVG---RNIIGGSDSVESANREIALWF-----------------
85 PsiBlast_CBE 77.1153%-118 - C7 -4CP5 NDKC_DICDI B:[9-138] ---ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLV-PTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPL-AS---APGSIRGDFGVDVG---RNIIGGSDSVESANREIALWF-----------------
71 PsiBlast_CBE 77.0554%-113 - C7 -1B99 NDKC_DICDI C:[9-138] ---ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLV-PTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPL-AS---APGSIRGDFGVDVG---RNIIHGSDSVESANREIALWF-----------------
91 PsiBlast_CBE 76.9253%-118 - C7 -3FKB NDKC_DICDI B:[9-138] ---ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLV-PTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPL-AS---APGSIRGDFGVDVG---RNIIGGSDSVESANREIALWF-----------------
63 PsiBlast_CBE 76.7354%-112 - C7 -1F6T NDKC_DICDI B:[9-138] ---ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLV-PTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPL-AS---APGSIRGDFGVDVG---RNIIHGSDSVESANREIALWF-----------------
101 PsiBlast_CBE 76.5553%-114 - C7 -1B4S NDKC_DICDI A:[9-138] ---ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLV-PTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPL-AS---APGSIRGDFGVDVG---RNIIGGSDSVESANREIALWF-----------------
82 PsiBlast_CBE 76.5553%-116 - C7 -4CP5 NDKC_DICDI E:[9-138] ---ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLV-PTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPL-AS---APGSIRGDFGVDVG---RNIIGGSDSVESANREIALWF-----------------
65 PsiBlast_CBE 76.5254%-114 - C7 -1BUX NDKC_DICDI C:[9-138] ---ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLV-PTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPL-AS---APGSIRGDFGVDVG---RNIIHGSDSVESANREIALWF-----------------
52 PsiBlast_CBE 76.4154%-119 - C7 -1S5Z NDKC_DICDI A:[9-138] ---ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLV-PTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPL-AS---APGSIRGDFGVDVG---RNIIHGSDSVESANREIALWF-----------------
81 PsiBlast_CBE 76.3453%-116 - C7 -4CP5 NDKC_DICDI F:[9-138] ---ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLV-PTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPL-AS---APGSIRGDFGVDVG---RNIIGGSDSVESANREIALWF-----------------
97 PsiBlast_CBE 76.2753%-113 - C7 -1F3F NDKC_DICDI B:[9-138] ---ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLV-PTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPL-AS---APGSIRGDFGVDVG---RNIIGGSDSVESANREIALWF-----------------
98 PsiBlast_CBE 76.1853%-112 - C7 -1F3F NDKC_DICDI A:[9-138] ---ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLV-PTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPL-AS---APGSIRGDFGVDVG---RNIIGGSDSVESANREIALWF-----------------
79 PsiBlast_CBE 76.1853%-115 - C7 -1LWX NDKC_DICDI B:[9-138] ---ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLV-PTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPL-AS---APGSIRGDFGVDVG---RAIIHGSDSVESANREIALWF-----------------