@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Rv2764c: (2016-05-13 )
MTPYEDLLRFVLETGTPKSDRTGTGTRSLFGQQMRYDLSAGFPLLTTKKVHFKSVAYELLWFLRGDSNIGWLHEHGVTIWDEWASDTGELGPIYGVQWRSWPAPSGEHIDQISAALDLLRTDPDSRRIIVSAWNVGEIERMALPPCHAFFQFYVADGRLSCQLYQRSADLFLGVPFNIASYALLTHMMAAQAGLSVGEFIWTGGDCHIYDNHVEQVRLQLSREPRPYPKLLLADRDSIFEYTYEDIVVKNYDPHPAIKAPVAV

Atome Classification :

(99 SA) .........10........20........30-........40.........50........60........70........80....------------.--------------------------------------------------...90........100...----------------------------------....110.......120.......130.......140.......150....------...160.......170.......180.......190.......200.......210.......220.......230...------------....240.......250.......260.
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MTPYEDLLRFVLETGTPKSDRTGTGTRSLFG-QQMRYDLSA-GFPLLTTKKVHFKSVAYELLWFLRGDSNIGWLHEHGVTIWDEWAS------------D--------------------------------------------------TGELGPIYGVQWRSWPAPS----------------------------------GEHIDQISAALDLLRTDPDSRRIIVSAWNVGEIERMALPPCHAFFQFYVAD------GRLSCQLYQRSADLFLGVPFNIASYALLTHMMAAQAGLSVGEFIWTGGDCHIYDNHVEQVRLQLSREPRPYPKLLLADR------------DSIFEYTYEDIVVKNYDPHPAIKAPVAV
29 PsiBlast_CBE 97.29100%-142 - C8 -4FOX TYSY_MYCTU G:[1-260] MTPYEDLLRFVLETGTPKSDRTGTGTRSLFG-QQMRYDLSA-GFPLLTTKKVHFKSVAYELLWFLRGDSNIGWLHEHGVTIWDEWAS------------D--------------------------------------------------TGELGPIYGVQWRSWPAPS----------------------------------GEHIDQISAALDLLRTDPDSRRIIVSAWNVGEIERMALPPCHAFFQFYVAD------GRLSCQLYQRSADLFLGVPFNIASYALLTHMMAAQAGLSVGEFIWTGGDCHIYDNHVEQVRLQLSREPRPYPKLLLADR------------DSIFEYTYEDIVVKNYDPHPAIKAP---
33 PsiBlast_CBE 97.28100%-144 - C8 -4FOX TYSY_MYCTU C:[1-261] MTPYEDLLRFVLETGTPKSDRTGTGTRSLFG-QQMRYDLSA-GFPLLTTKKVHFKSVAYELLWFLRGDSNIGWLHEHGVTIWDEWAS------------D--------------------------------------------------TGELGPIYGVQWRSWPAPS----------------------------------GEHIDQISAALDLLRTDPDSRRIIVSAWNVGEIERMALPPCHAFFQFYVAD------GRLSCQLYQRSADLFLGVPFNIASYALLTHMMAAQAGLSVGEFIWTGGDCHIYDNHVEQVRLQLSREPRPYPKLLLADR------------DSIFEYTYEDIVVKNYDPHPAIKAPV--
4 PsiBlast_PDB 97.13100%-143 - C8 -4FOX TYSY_MYCTU A:[1-261] MTPYEDLLRFVLETGTPKSDRTGTGTRSLFG-QQMRYDLSA-GFPLLTTKKVHFKSVAYELLWFLRGDSNIGWLHEHGVTIWDEWAS------------D--------------------------------------------------TGELGPIYGVQWRSWPAPS----------------------------------GEHIDQISAALDLLRTDPDSRRIIVSAWNVGEIERMALPPCHAFFQFYVAD------GRLSCQLYQRSADLFLGVPFNIASYALLTHMMAAQAGLSVGEFIWTGGDCHIYDNHVEQVRLQLSREPRPYPKLLLADR------------DSIFEYTYEDIVVKNYDPHPAIKAPV--
108 HHSearch 97.04100%-136 - C8 -4FQS TYSY_MYCTU A:[1-263] MTPYEDLLRFVLETGTPKSDRTGTGTRSLFG-QQMRYDLSA-GFPLLTTKKVHFKSVAYELLWFLRGDSNIGWLHEHGVTIWDEWAS------------D--------------------------------------------------TGELGPIYGVQWRSWPAPS----------------------------------GEHIDQISAALDLLRTDPDSRRIIVSAWNVGEIERMALPPCHAFFQFYVAD------GRLSCQLYQRSADLFLGVPFNIASYALLTHMMAAQAGLSVGEFIWTGGDCHIYDNHVEQVRLQLSREPRPYPKLLLADR------------DSIFEYTYEDIVVKNYDPHPAIKAPVAV
5 PsiBlast_PDB 97.04100%-136 - C8 -4FQS TYSY_MYCTU A:[1-263] MTPYEDLLRFVLETGTPKSDRTGTGTRSLFG-QQMRYDLSA-GFPLLTTKKVHFKSVAYELLWFLRGDSNIGWLHEHGVTIWDEWAS------------D--------------------------------------------------TGELGPIYGVQWRSWPAPS----------------------------------GEHIDQISAALDLLRTDPDSRRIIVSAWNVGEIERMALPPCHAFFQFYVAD------GRLSCQLYQRSADLFLGVPFNIASYALLTHMMAAQAGLSVGEFIWTGGDCHIYDNHVEQVRLQLSREPRPYPKLLLADR------------DSIFEYTYEDIVVKNYDPHPAIKAPVAV
27 PsiBlast_CBE 96.61100%-135 - C8 -4FQS TYSY_MYCTU B:[1-263] MTPYEDLLRFVLETGTPKSDRTGTGTRSLFG-QQMRYDLSA-GFPLLTTKKVHFKSVAYELLWFLRGDSNIGWLHEHGVTIWDEWAS------------D--------------------------------------------------TGELGPIYGVQWRSWPAPS----------------------------------GEHIDQISAALDLLRTDPDSRRIIVSAWNVGEIERMALPPCHAFFQFYVAD------GRLSCQLYQRSADLFLGVPFNIASYALLTHMMAAQAGLSVGEFIWTGGDCHIYDNHVEQVRLQLSREPRPYPKLLLADR------------DSIFEYTYEDIVVKNYDPHPAIKAPVAV
30 PsiBlast_CBE 96.59100%-140 - C8 -4FOX TYSY_MYCTU F:[1-261] MTPYEDLLRFVLETGTPKSDRTGTGTRSLFG-QQMRYDLSA-GFPLLTTKKVHFKSVAYELLWFLRGDSNIGWLHEHGVTIWDEWAS------------D--------------------------------------------------TGELGPIYGVQWRSWPAPS----------------------------------GEHIDQISAALDLLRTDPDSRRIIVSAWNVGEIERMALPPCHAFFQFYVAD------GRLSCQLYQRSADLFLGVPFNIASYALLTHMMAAQAGLSVGEFIWTGGDCHIYDNHVEQVRLQLSREPRPYPKLLLADR------------DSIFEYTYEDIVVKNYDPHPAIKAPV--
32 PsiBlast_CBE 96.46100%-139 - C8 -4FOX TYSY_MYCTU D:[1-263] MTPYEDLLRFVLETGTPKSDRTGTGTRSLFG-QQMRYDLSA-GFPLLTTKKVHFKSVAYELLWFLRGDSNIGWLHEHGVTIWDEWAS------------D--------------------------------------------------TGELGPIYGVQWRSWPAPS----------------------------------GEHIDQISAALDLLRTDPDSRRIIVSAWNVGEIERMALPPCHAFFQFYVAD------GRLSCQLYQRSADLFLGVPFNIASYALLTHMMAAQAGLSVGEFIWTGGDCHIYDNHVEQVRLQLSREPRPYPKLLLADR------------DSIFEYTYEDIVVKNYDPHPAIKAPVAV
22 PsiBlast_CBE 96.40100%-139 - C8 -4FOA TYSY_MYCTU C:[2-261] MTPYEDLLRFVLETGTPKSDRTGTGTRSLFG-QQMRYDLSA-GFPLLTTKKVHFKSVAYELLWFLRGDSNIGWLHEHGVTIWDEWAS------------D--------------------------------------------------TGELGPIYGVQWRSWPAPS----------------------------------GEHIDQISAALDLLRTDPDSRRIIVSAWNVGEIERMALPPCHAFFQFYVAD------GRLSCQLYQRSADLFLGVPFNIASYALLTHMMAAQAGLSVGEFIWTGGDCHIYDNHVEQVRLQLSREPRPYPKLLLADR------------DSIFEYTYEDIVVKNYDPHPAIKAP---
34 PsiBlast_CBE 96.38100%-138 - C8 -4FOX TYSY_MYCTU B:[1-261] MTPYEDLLRFVLETGTPKSDRTGTGTRSLFG-QQMRYDLSA-GFPLLTTKKVHFKSVAYELLWFLRGDSNIGWLHEHGVTIWDEWAS------------D--------------------------------------------------TGELGPIYGVQWRSWPAPS----------------------------------GEHIDQISAALDLLRTDPDSRRIIVSAWNVGEIERMALPPCHAFFQFYVAD------GRLSCQLYQRSADLFLGVPFNIASYALLTHMMAAQAGLSVGEFIWTGGDCHIYDNHVEQVRLQLSREPRPYPKLLLADR------------DSIFEYTYEDIVVKNYDPHPAIKAPV--
35 PsiBlast_CBE 96.30100%-138 - C8 -4FOG TYSY_MYCTU D:[1-263] MTPYEDLLRFVLETGTPKSDRTGTGTRSLFG-QQMRYDLSA-GFPLLTTKKVHFKSVAYELLWFLRGDSNIGWLHEHGVTIWDEWAS------------D--------------------------------------------------TGELGPIYGVQWRSWPAPS----------------------------------GEHIDQISAALDLLRTDPDSRRIIVSAWNVGEIERMALPPCHAFFQFYVAD------GRLSCQLYQRSADLFLGVPFNIASYALLTHMMAAQAGLSVGEFIWTGGDCHIYDNHVEQVRLQLSREPRPYPKLLLADR------------DSIFEYTYEDIVVKNYDPHPAIKAPVAV
31 PsiBlast_CBE 96.29100%-140 - C8 -4FOX TYSY_MYCTU E:[1-260] MTPYEDLLRFVLETGTPKSDRTGTGTRSLFG-QQMRYDLSA-GFPLLTTKKVHFKSVAYELLWFLRGDSNIGWLHEHGVTIWDEWAS------------D--------------------------------------------------TGELGPIYGVQWRSWPAPS----------------------------------GEHIDQISAALDLLRTDPDSRRIIVSAWNVGEIERMALPPCHAFFQFYVAD------GRLSCQLYQRSADLFLGVPFNIASYALLTHMMAAQAGLSVGEFIWTGGDCHIYDNHVEQVRLQLSREPRPYPKLLLADR------------DSIFEYTYEDIVVKNYDPHPAIKAP---
2 PsiBlast_PDB 96.16100%-139 - C8 -4FOA TYSY_MYCTU A:[2-261] MTPYEDLLRFVLETGTPKSDRTGTGTRSLFG-QQMRYDLSA-GFPLLTTKKVHFKSVAYELLWFLRGDSNIGWLHEHGVTIWDEWAS------------D--------------------------------------------------TGELGPIYGVQWRSWPAPS----------------------------------GEHIDQISAALDLLRTDPDSRRIIVSAWNVGEIERMALPPCHAFFQFYVAD------GRLSCQLYQRSADLFLGVPFNIASYALLTHMMAAQAGLSVGEFIWTGGDCHIYDNHVEQVRLQLSREPRPYPKLLLADR------------DSIFEYTYEDIVVKNYDPHPAIKAP---
21 PsiBlast_CBE 96.06100%-139 - C8 -4FOA TYSY_MYCTU D:[2-262] MTPYEDLLRFVLETGTPKSDRTGTGTRSLFG-QQMRYDLSA-GFPLLTTKKVHFKSVAYELLWFLRGDSNIGWLHEHGVTIWDEWAS------------D--------------------------------------------------TGELGPIYGVQWRSWPAPS----------------------------------GEHIDQISAALDLLRTDPDSRRIIVSAWNVGEIERMALPPCHAFFQFYVAD------GRLSCQLYQRSADLFLGVPFNIASYALLTHMMAAQAGLSVGEFIWTGGDCHIYDNHVEQVRLQLSREPRPYPKLLLADR------------DSIFEYTYEDIVVKNYDPHPAIKAPV--
3 PsiBlast_PDB 95.95100%-141 - C8 -4FOG TYSY_MYCTU A:[1-260] MTPYEDLLRFVLETGTPKSDRTGTGTRSLFG-QQMRYDLSA-GFPLLTTKKVHFKSVAYELLWFLRGDSNIGWLHEHGVTIWDEWAS------------D--------------------------------------------------TGELGPIYGVQWRSWPAPS----------------------------------GEHIDQISAALDLLRTDPDSRRIIVSAWNVGEIERMALPPCHAFFQFYVAD------GRLSCQLYQRSADLFLGVPFNIASYALLTHMMAAQAGLSVGEFIWTGGDCHIYDNHVEQVRLQLSREPRPYPKLLLADR------------DSIFEYTYEDIVVKNYDPHPAIKAP---
28 PsiBlast_CBE 95.85100%-140 - C8 -4FOX TYSY_MYCTU H:[1-259] MTPYEDLLRFVLETGTPKSDRTGTGTRSLFG-QQMRYDLSA-GFPLLTTKKVHFKSVAYELLWFLRGDSNIGWLHEHGVTIWDEWAS------------D--------------------------------------------------TGELGPIYGVQWRSWPAPS----------------------------------GEHIDQISAALDLLRTDPDSRRIIVSAWNVGEIERMALPPCHAFFQFYVAD------GRLSCQLYQRSADLFLGVPFNIASYALLTHMMAAQAGLSVGEFIWTGGDCHIYDNHVEQVRLQLSREPRPYPKLLLADR------------DSIFEYTYEDIVVKNYDPHPAIKA----
25 PsiBlast_CBE 95.78100%-141 - C8 -3QJ7 TYSY_MYCTU C:[2-262] MTPYEDLLRFVLETGTPKSD--GTGTRSLFG-QQMRYDLSA-GFPLLTTKKVHFKSVAYELLWFLRGDSNIGWLHEHGVTIWDEWAS------------D--------------------------------------------------TGELGPIYGVQWRSWPAPS----------------------------------GEHIDQISAALDLLRTDPDSRRIIVSAWNVGEIERMALPPCHAFFQFYVAD------GRLSCQLYQRSADLFLGVPFNIASYALLTHMMAAQAGLSVGEFIWTGGDCHIYDNHVEQVRLQLSREPRPYPKLLLADR------------DSIFEYTYEDIVVKNYDPHPAIKAPV--
24 PsiBlast_CBE 95.77100%-141 - C8 -3QJ7 TYSY_MYCTU D:[2-264] MTPYEDLLRFVLETGTPKS---GTGTRSLFG-QQMRYDLSA-GFPLLTTKKVHFKSVAYELLWFLRGDSNIGWLHEHGVTIWDEWAS------------D--------------------------------------------------TGELGPIYGVQWRSWPAPS----------------------------------GEHIDQISAALDLLRTDPDSRRIIVSAWNVGEIERMALPPCHAFFQFYVAD------GRLSCQLYQRSADLFLGVPFNIASYALLTHMMAAQAGLSVGEFIWTGGDCHIYDNHVEQVRLQLSREPRPYPKLLLADR------------DSIFEYTYEDIVVKNYDPHPAIKAPVAV
36 PsiBlast_CBE 95.62100%-134 - C8 -4FOG TYSY_MYCTU C:[1-262] MTPYEDLLRFVLETGTPKSDRTGTGTRSLFG-QQMRYDLSA-GFPLLTTKKVHFKSVAYELLWFLRGDSNIGWLHEHGVTIWDEWAS------------D--------------------------------------------------TGELGPIYGVQWRSWPAPS----------------------------------GEHIDQISAALDLLRTDPDSRRIIVSAWNVGEIERMALPPCHAFFQFYVAD------GRLSCQLYQRSADLFLGVPFNIASYALLTHMMAAQAGLSVGEFIWTGGDCHIYDNHVEQVRLQLSREPRPYPKLLLADR------------DSIFEYTYEDIVVKNYDPHPAIKAPVA-
1 PsiBlast_PDB 95.61100%-138 - C8 -3QJ7 TYSY_MYCTU A:[2-261] MTPYEDLLRFVLETGTPKSDRTGTGTRSLFG-QQMRYDLSA-GFPLLTTKKVHFKSVAYELLWFLRGDSNIGWLHEHGVTIWDEWAS------------D--------------------------------------------------TGELGPIYGVQWRSWPAPS----------------------------------GEHIDQISAALDLLRTDPDSRRIIVSAWNVGEIERMALPPCHAFFQFYVAD------GRLSCQLYQRSADLFLGVPFNIASYALLTHMMAAQAGLSVGEFIWTGGDCHIYDNHVEQVRLQLSREPRPYPKLLLADR------------DSIFEYTYEDIVVKNYDPHPAIKAP---
26 PsiBlast_CBE 95.60100%-142 - C8 -3QJ7 TYSY_MYCTU B:[2-261] MTPYEDLLRFVLETGTPKS---GTGTRSLFG-QQMRYDLSA-GFPLLTTKKVHFKSVAYELLWFLRGDSNIGWLHEHGVTIWDEWAS------------D--------------------------------------------------TGELGPIYGVQWRSWPAPS----------------------------------GEHIDQISAALDLLRTDPDSRRIIVSAWNVGEIERMALPPCHAFFQFYVAD------GRLSCQLYQRSADLFLGVPFNIASYALLTHMMAAQAGLSVGEFIWTGGDCHIYDNHVEQVRLQLSREPRPYPKLLLADR------------DSIFEYTYEDIVVKNYDPHPAIKAP---
37 PsiBlast_CBE 95.42100%-141 - C8 -4FOG TYSY_MYCTU B:[1-260] MTPYEDLLRFVLETGTPKSD--GTGTRSLFG-QQMRYDLSA-GFPLLTTKKVHFKSVAYELLWFLRGDSNIGWLHEHGVTIWDEWAS------------D--------------------------------------------------TGELGPIYGVQWRSWPAPS----------------------------------GEHIDQISAALDLLRTDPDSRRIIVSAWNVGEIERMALPPCHAFFQFYVAD------GRLSCQLYQRSADLFLGVPFNIASYALLTHMMAAQAGLSVGEFIWTGGDCHIYDNHVEQVRLQLSREPRPYPKLLLADR------------DSIFEYTYEDIVVKNYDPHPAIKAP---
23 PsiBlast_CBE 95.04100%-141 - C8 -4FOA TYSY_MYCTU B:[2-262] MTPYEDLLRFVLETGTPKSD---TGTRSLFG-QQMRYDLSA-GFPLLTTKKVHFKSVAYELLWFLRGDSNIGWLHEHGVTIWDEWAS------------D--------------------------------------------------TGELGPIYGVQWRSWPAPS----------------------------------GEHIDQISAALDLLRTDPDSRRIIVSAWNVGEIERMALPPCHAFFQFYVAD------GRLSCQLYQRSADLFLGVPFNIASYALLTHMMAAQAGLSVGEFIWTGGDCHIYDNHVEQVRLQLSREPRPYPKLLLADR------------DSIFEYTYEDIVVKNYDPHPAIKAPV--
7 PsiBlast_PDB 86.4473%-141 - C8 -4H0U TYSY_CORGL A:[5-264] -TPYEDLLRKIAEEGSHKD----TGTTSLFG-QQIRFDLNE-GFPLLTTKKVHFHSVVGELLWFLQGDSNVKWLQDNNIRIWNEWAD------------E--------------------------------------------------DGELGPVYGVQWRSWPTPD----------------------------------GRHIDQISGALETLRNNPDSRRNIVSAWNVSELENMALPPCHLLFQLYVAD------GKLSCQLYQRSADMFLGVPFNIASYALLTHMFAQQAGLEVGEFIWTGGDCHIYDNHKEQVAEQLSREARPYPTLELNKA------------ASMFEYSFDDITVSGYDPHPLIRGKV--
38 PsiBlast_CBE 86.3773%-143 - C8 -4H0U TYSY_CORGL D:[5-260] -TPYEDLLRKIAEEGSHKD-----GTTSLFG-QQIRFDLNE-GFPLLTTKKVHFHSVVGELLWFLQGDSNVKWLQDNNIRIWNEWAD------------E--------------------------------------------------DGELGPVYGVQWRSWPTPD----------------------------------GRHIDQISGALETLRNNPDSRRNIVSAWNVSELENMALPPCHLLFQLYVAD------GKLSCQLYQRSADMFLGVPFNIASYALLTHMFAQQAGLEVGEFIWTGGDCHIYDNHKEQVAEQLSREARPYPTLELNKA------------ASMFEYSFDDITVSGYDPHPLI------
40 PsiBlast_CBE 85.8173%-139 - C8 -4H0U TYSY_CORGL B:[5-261] -TPYEDLLRKIAEEGSHKD---GTGTTSLFG-QQIRFDLNE-GFPLLTTKKVHFHSVVGELLWFLQGDSNVKWLQDNNIRIWNEWAD------------E--------------------------------------------------DGELGPVYGVQWRSWPTPD----------------------------------GRHIDQISGALETLRNNPDSRRNIVSAWNVSELENMALPPCHLLFQLYVAD------GKLSCQLYQRSADMFLGVPFNIASYALLTHMFAQQAGLEVGEFIWTGGDCHIYDNHKEQVAEQLSREARPYPTLELNKA------------ASMFEYSFDDITVSGYDPHPLIR-----
42 PsiBlast_CBE 85.4566%-131 - C8 -2BBQ TYSY_ECOLI B:[1-264] MKQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQD-GFPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWAD------------E--------------------------------------------------NGDLGPVYGKQWRAWPTPD----------------------------------GRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVAD------GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKP-----------ESIFDYRFEDFEIEGYDPHPGIKAPVAI
54 PsiBlast_CBE 85.4165%-130 - C8 -2VET TYSY_ECOLI A:[1-264] MKQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQD-GFPLVTTQRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWAD------------E--------------------------------------------------NGDLGPVYGKQWRAWPTPD----------------------------------GRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVAD------GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKP-----------ESIFDYRFEDFEIEGYDPHPGIKAPVAI
53 PsiBlast_CBE 85.2265%-126 - C8 -3B5B TYSY_ECOLI A:[1-264] MKQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQD-GFPLVTTQRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWAD------------E--------------------------------------------------NGDLGPVYGKQWRAWPTPD----------------------------------GRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVAD------GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKP-----------ESIFDYRFEDFEIEGYDPHPGIKAPVAI
56 PsiBlast_CBE 85.1166%-132 - C8 -2TSC TYSY_ECOLI A:[1-264] MKQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQD-GFPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWAD------------E--------------------------------------------------NGDLGPVYGKQWRAWPTPD----------------------------------GRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVAD------GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRAP-----------ESIFDYRFEDFEIEGYDPHPGIKAPVAI
9 PsiBlast_PDB 85.0766%-130 - C8 -2KCE TYSY_ECOLI A:[1-264] MKQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQD-GFPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWAD------------E--------------------------------------------------NGDLGPVYGKQWRAWPTPD----------------------------------GRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVAD------GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKP-----------ESIFDYRFEDFEIEGYDPHPGIKAPVAI
52 PsiBlast_CBE 85.0565%-127 - C8 -3B5B TYSY_ECOLI B:[1-264] MKQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQD-GFPLVTTQRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWAD------------E--------------------------------------------------NGDLGPVYGKQWRAWPTPD----------------------------------GRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVAD------GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKP-----------ESIFDYRFEDFEIEGYDPHPGIKAPVAI
55 PsiBlast_CBE 84.4566%-132 - C8 -2TSC TYSY_ECOLI B:[1-264] MKQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQD-GFPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWAD------------E--------------------------------------------------NGDLGPVYGKQWRAWPTPD----------------------------------GRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVAD------GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRAP-----------ESIFDYRFEDFEIEGYDPHPGIKAPVAI
39 PsiBlast_CBE 84.3273%-137 - C8 -4H0U TYSY_CORGL C:[5-260] -TPYEDLLRKIAEEGSHK------GTTSLFG-QQIRFDLNE-GFPLLTTKKVHFHSVVGELLWFLQGDSNVKWLQDNNIRIWNEWAD------------E--------------------------------------------------DGELGPVYGVQWRSWPTPD----------------------------------GRHIDQISGALETLRNNPDSRRNIVSAWNVSELENMALPPCHLLFQLYVAD------GKLSCQLYQRSADMFLGVPFNIASYALLTHMFAQQAGLEVGEFIWTGGDCHIYDNHKEQVAEQLSREARPYPTLELNKA------------ASMFEYSFDDITVSGYDPHPLI------
8 PsiBlast_PDB 84.2166%-127 - C8 -2BBQ TYSY_ECOLI A:[1-264] MKQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQD-GFPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWAD------------E--------------------------------------------------NGDLGPVYGKQWRAWPTPD----------------------------------GRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVAD------GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKP-----------ESIFDYRFEDFEIEGYDPHPGIKAPVAI