@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Rv2925c: (2016-05-15 )
MIRSRQPLLDALGVDLPDELLSLALTHRSYAYENGGLPTNERLEFLGDAVLGLTITDALFHRHPDRSEGDLAKLRASVVNTQALADVARRLCAEGLGVHVLLGRGEANTGGADKSSILADGMESLLGAIYLQHGMEKAREVILRLFGPLLDAAPTLGAGLDWKTSLQELTAARGLGAPSYLVTSTGPDHDKEFTAVVVVMDSEYGSGVGRSKKEAEQKAAAAAWKALEVLDNAMPGKTSA

Atome Classification :

(20 SA) -.........10.....-----.-.-.-20........30...-----.-----.-----...40........50........60........70........80........90........--100.......110.......120.......130.....--..140......-.150..-.....160.......170.......180..-..-....190.......200....-...210.......220.......230.......240
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) -MIRSRQPLLDALGVDL-----P-D-E-LLSLALTHRSYAYEN-----G-----G-----LPTNERLEFLGDAVLGLTITDALFHRHPDRSEGDLAKLRASVVNTQALADVARRLCAEGLGVH--VLLGRGEANTGGADKSSILADGMESLLGAIYLQHGMEK--AREVILRLFGP-LLDAAP-TLGAGLDWKTSLQELTAARGLGAPSY-LVT-ST-GPDHDKEFTAVVVVMDSEYGS-GVGRSKKEAEQKAAAAAWKALEVLDNAMPGKTSA
51 HHSearch 89.00100%-129 - C2 -2A11 RNC_MYCTU A:[4-157] --IRSRQPLLDALGVDL-----P-D-E-LLSLALTHRSYAYEN-----G-----G-----LPTNERLEFLGDAVLGLTITDALFHRHPDRSEGDLAKLRASVVNTQALADVARRLCAEGLGVH--VLLGRGEANTGGADKSSILADGMESLLGAIYLQHGMEK--AREVILRLFGP-LLDAAP-T-----------------------------------------------------------------------------------------
1 PsiBlast_PDB 89.00100%-129 - C2 -2A11 RNC_MYCTU A:[4-157] --IRSRQPLLDALGVDL-----P-D-E-LLSLALTHRSYAYEN-----G-----G-----LPTNERLEFLGDAVLGLTITDALFHRHPDRSEGDLAKLRASVVNTQALADVARRLCAEGLGVH--VLLGRGEANTGGADKSSILADGMESLLGAIYLQHGMEK--AREVILRLFGP-LLDAAP-T-----------------------------------------------------------------------------------------
73 Fugue 76.3538% -70 - C1 -1O0W - RNC_THEMA A:[-1-236] HMNESERKIVEEFQKETGINFKN-E-E-LLFRALCHSSYANEQ-----NQAGRKD-----VESNEKLEFLGDAVLELFVCEILYKKYPEAEVGDLARVKSAAASEEVLAMVSRKM---NLGKF--LFLGKGEEKTGGRDRDSILADAFEALLAAIYLDQGYEK--IKELFEQEFEF-YIEKIM-KGEMLFDYKTALQEIVQSEHKVPPEY-ILV-RTEKNDGDRIFVVEVRVNGKTIAT-GKGRTKKEAEKEAARIAYEKLL------------
53 HHSearch 76.1738% -77 * C1 *1O0W - RNC_THEMA A:[8-236] ----IVEEFQKETGINF-----K-NEE-LLFRALCHSSYANEQNQAGRK-----D-----VESNEKLEFLGDAVLELFVCEILYKKYPEAEVGDLARVKSAAASEEVLAMVSRKMN---LGKF--LFLGKGEEKTGGRDRDSILADAFEALLAAIYLDQGYEK--IKELFEQEFEF-YIEKIM-KGEMLFDYKTALQEIVQSEHKVPPEY-ILVRTE-KNDGDRIFVVEVRVNGKTIAT-GKGRTKKEAEKEAARIAYEKLL------------
9 PsiBlast_PDB 74.9235%-105 - C2 -2NUG RNC_AQUAE A:[5-218] ------EQLEKKLGYTF-----K-D-KSLLEKALTHVSYSKKE-----H--------------YETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFF-----NLLAQKLELHKFIRIKRGKIN------ETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIK-EGRVKKDYKTILQEITQKRWKERPEYRLIS-VE-GPHHKKKF--IVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLE------------
24 PsiBlast_CBE 74.8735%-106 - C2 -2NUG RNC_AQUAE B:[5-218] ------EQLEKKLGYTF-----K-D-KSLLEKALTHVSYSKKE-----H--------------YETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFF-----NLLAQKLELHKFIRIKRGKIN------ETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIK-EGRVKKDYKTILQEITQKRWKERPEYRLIS-VE-GPHHKKKF--IVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLE------------
15 PsiBlast_PDB 74.8535% -99 - C2 -2EZ6 RNC_AQUAE A:[5-218] ------EQLEKKLGYTF-----K-D-KSLLEKALTHVSYSKKE-----H--------------YETLEFLGNALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFF-----NLLAQKLELHKFIRIKRGKIN------ETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIK-EGRVKKDYKTILQEITQKRWKERPEYRLIS-VE-GPHHKKKF--IVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLE------------
30 PsiBlast_CBE 74.8435%-101 - C2 -2EZ6 RNC_AQUAE B:[5-218] ------EQLEKKLGYTF-----K-D-KSLLEKALTHVSYSKKE-----H--------------YETLEFLGNALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFF-----NLLAQKLELHKFIRIKRGKIN------ETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIK-EGRVKKDYKTILQEITQKRWKERPEYRLIS-VE-GPHHKKKF--IVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLE------------
11 PsiBlast_PDB 74.7835%-100 - C2 -4M30 RNC_AQUAE A:[5-218] ------EQLEKKLGYTF-----K-D-KSLLEKALTHVSYSKKE-----H--------------YETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFF-----NLLAQKLELHKFIRIKRGKIN------ETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIK-EGRVKKDYKTILQEITQKRWKERPEYRLIS-VE-GPHHKKKF--IVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLE------------
5 PsiBlast_PDB 74.6335%-108 - C2 -1YYK RNC_AQUAE A:[5-218] ------EQLEKKLGYTF-----K-D-KSLLEKALTHVSYSKKE-----H--------------YETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFF-----NLLAQKLELHKFIRIKRGKIN------ETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIK-EGRVKKDYKTILQEITQKRWKERPEYRLIS-VE-GPHHKKKF--IVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLE------------
8 PsiBlast_PDB 74.4835% -99 - C2 -2NUF RNC_AQUAE A:[5-218] ------EQLEKKLGYTF-----K-D-KSLLEKALTHVSYSKKE-----H--------------YETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFF-----NLLAQKLELHKFIRIKRGKIN------ETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIK-EGRVKKDYKTILQEITQKRWKERPEYRLIS-VE-GPHHKKKF--IVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLE------------
12 PsiBlast_PDB 74.2635%-100 - C2 -1YZ9 RNC_AQUAE A:[5-218] ------EQLEKKLGYTF-----K-D-KSLLEKALTHVSYSKKE-----H--------------YETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFF-----NLLAQKLELHKFIRIKRGKIN------ETIIGDVFQALWAAVYIDSGRDANFTRELFYKLFKEDILSAIK-EGRVKKDYKTILQEITQKRWKERPEYRLIS-VE-GPHHKKKF--IVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLE------------
10 PsiBlast_PDB 74.1435% -98 - C2 -4M2Z RNC_AQUAE A:[5-218] ------EQLEKKLGYTF-----K-D-KSLLEKALTHVSYSKKE-----H--------------YETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFF-----NLLAQKLELHKFIRIKRGKIN------ETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIK-EGRVKKDYKTILQEITQKRWKERPEYRLIS-VE-GPHHKKKF--IVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLE------------
22 PsiBlast_CBE 73.8535%-101 - C2 -4M30 RNC_AQUAE B:[5-218] ------EQLEKKLGYTF-----K-D-KSLLEKALTHVSYSKKE-----H--------------YETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFF-----NLLAQKLELHKFIRIKRGKIN------ETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIK-EGRVKKDYKTILQEITQKRWKERPEYRLIS-VE-GPHHKKKF--IVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLE------------
27 PsiBlast_CBE 73.4635% -98 * C2 *1YYK RNC_AQUAE B:[5-218] ------EQLEKKLGYTF-----K-D-KSLLEKALTHVSYSKKE-----H--------------YETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFF-----NLLAQKLELHKFIRIKRGKIN------ETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIK-EGRVKKDYKTILQEITQKRWKERPEYRLIS-VE-GPHHKKKF--IVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLE------------
28 PsiBlast_CBE 73.2635%-100 - C2 -1YZ9 RNC_AQUAE B:[5-218] ------EQLEKKLGYTF-----K-D-KSLLEKALTHVSYSKKE-----H--------------YETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFF-----NLLAQKLELHKFIRIKRGKIN------ETIIGDVFQALWAAVYIDSGRDANFTRELFYKLFKEDILSAIK-EGRVKKDYKTILQEITQKRWKERPEYRLIS-VE-GPHHKKKF--IVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLE------------
25 PsiBlast_CBE 73.1435%-101 - C2 -2NUF RNC_AQUAE B:[5-218] ------EQLEKKLGYTF-----K-D-KSLLEKALTHVSYSKKE-----H--------------YETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFF-----NLLAQKLELHKFIRIKRGKIN------ETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIK-EGRVKKDYKTILQEITQKRWKERPEYRLIS-VE-GPHHKKKF--IVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLE------------
56 HHSearch 73.0735% -98 - C2 -2NUG RNC_AQUAE A:[3-218] ----MLEQLEKKLGYTF-----K-DKS-LLEKALTHVSYSK-------------------KEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLE---LHKF--IRIKRG------KINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKE-DILSAIKEGRVKKDYKTILQEITQKRWKERPEY-RLISVE-GPHHKKKFIVEAKIKEY-RTL-GEGKSKKEAEQRAAEELIKLLE------------
23 PsiBlast_CBE 72.8935%-105 - C2 -4M2Z RNC_AQUAE B:[5-218] ------EQLEKKLGYTF-----K-D-KSLLEKALTHVSYSKKE-----H--------------YETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFF-----NLLAQKLELHKFIRIKRGKIN------ETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIK-EGRVKKDYKTILQEITQKRWKERPEYRLIS-VE-GPHHKKKF--IVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLE------------
3 PsiBlast_PDB 72.5239% -72 - C1 -1O0W - RNC_THEMA A:[17-235] -------------GINF-----KNE-E-LLFRALCHSSYANEQ-----N-----QAGRKDVESNEKLEFLGDAVLELFVCEILYKKYPEAEVGDLARVKSAAASEEVLAMVSRKM---NLGKF--LFLGKGEEKTGGRDRDSILADAFEALLAAIYLDQGYEK--IKELFEQEFEF-YIEKIM-KGEMLFDYKTALQEIVQSEHKVPPEYILVR-TE-KNDGDRIFVVEVRVNGKTIAT-GKGRTKKEAEKEAARIAYEKL-------------