@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Rv2965c: (2016-05-15 )
MTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKTGMFDLDERIAMVKESTTHLPNLRVQVGHGLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKHIAGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRLNTERT

Atome Classification :

(39 SA) .........10........20........30........40.-.......50........60........70.........80........90........100.....-.-.-110........120.......130.......140.......150.......160
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-GMFDLDERIAMVKESTTHLPNLRVQVGH-GLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKH-I-A-G-VDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRLNTERT
25 PsiBlast_CBE 97.78100%-149 - C3 -3NBK COAD_MYCTU C:[21-177] MTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-GMFDLDERIAMVKESTTHLPNLRVQVGH-GLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKH-I-A-G-VDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRLN----
23 PsiBlast_CBE 97.55100%-151 - C3 -3PNB COAD_MYCTU B:[21-177] MTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-GMFDLDERIAMVKESTTHLPNLRVQVGH-GLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKH-I-A-G-VDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRLN----
24 PsiBlast_CBE 97.44100%-150 - C3 -3NBK COAD_MYCTU D:[21-177] MTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-GMFDLDERIAMVKESTTHLPNLRVQVGH-GLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKH-I-A-G-VDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRLN----
115 HHSearch 97.38100%-146 - C3 -3NBK COAD_MYCTU A:[21-177] MTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-GMFDLDERIAMVKESTTHLPNLRVQVGH-GLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKH-I-A-G-VDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRLN----
4 PsiBlast_PDB 97.37100%-146 - C3 -3NBK COAD_MYCTU A:[21-177] MTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-GMFDLDERIAMVKESTTHLPNLRVQVGH-GLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKH-I-A-G-VDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRLN----
22 PsiBlast_CBE 96.62100%-143 - C3 -3PNB COAD_MYCTU C:[21-177] MTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-GMFDLDERIAMVKESTTHLPNLRVQVGH-GLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKH-I-A-G-VDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRLN----
31 PsiBlast_CBE 96.51100%-151 - C3 -4R0N COAD_MYCTU I:[1-156] -TGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-GMFDLDERIAMVKESTTHLPNLRVQVGH-GLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKH-I-A-G-VDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRLN----
26 PsiBlast_CBE 96.46100%-146 - C3 -3NBK COAD_MYCTU B:[21-177] MTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-GMFDLDERIAMVKESTTHLPNLRVQVGH-GLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKH-I-A-G-VDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRLN----
7 PsiBlast_PDB 96.20100%-145 - C3 -3RBA COAD_MYCTU A:[1-157] MTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-GMFDLDERIAMVKESTTHLPNLRVQVGH-GLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKH-I-A-G-VDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRLN----
1 PsiBlast_PDB 96.17100%-148 - C3 -3LCJ COAD_MYCTU A:[1-157] MTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-GMFDLDERIAMVKESTTHLPNLRVQVGH-GLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKH-I-A-G-VDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRLN----
34 PsiBlast_CBE 95.66100%-146 - C3 -4R0N COAD_MYCTU C:[1-156] -TGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-GMFDLDERIAMVKESTTHLPNLRVQVGH-GLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKH-I-A-G-VDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRLN----
9 PsiBlast_PDB 95.65100%-145 - C3 -3RHS COAD_MYCTU A:[1-157] MTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-GMFDLDERIAMVKESTTHLPNLRVQVGH-GLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKH-I-A-G-VDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRLN----
5 PsiBlast_PDB 95.51100%-146 - C3 -3PNB COAD_MYCTU A:[21-177] MTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-GMFDLDERIAMVKESTTHLPNLRVQVGH-GLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKH-I-A-G-VDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRLN----
21 PsiBlast_CBE 95.44100%-147 - C3 -3PNB COAD_MYCTU D:[21-177] MTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-GMFDLDERIAMVKESTTHLPNLRVQVGH-GLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKH-I-A-G-VDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRLN----
2 PsiBlast_PDB 95.42100%-140 - C3 -4E1A COAD_MYCTU A:[1-157] MTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-GMFDLDERIAMVKESTTHLPNLRVQVGH-GLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKH-I-A-G-VDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRLN----
8 PsiBlast_PDB 95.33100%-142 - C3 -3RFF - COAD_MYCTU A:[1-157] MTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-GMFDLDERIAMVKESTTHLPNLRVQVGH-GLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKH-I-A-G-VDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRLN----
6 PsiBlast_PDB 95.31100%-144 - C3 -1TFU - COAD_MYCTU A:[1-157] MTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-GMFDLDERIAMVKESTTHLPNLRVQVGH-GLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKH-I-A-G-VDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRLN----
29 PsiBlast_CBE 94.94100%-146 - C3 -3NBA COAD_MYCTU B:[21-176] MTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-GMFDLDERIAMVKESTTHLPNLRVQVGH-GLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKH-I-A-G-VDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRL-----
30 PsiBlast_CBE 94.90100%-140 - C3 -4R0N COAD_MYCTU K:[1-156] -TGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-GMFDLDERIAMVKESTTHLPNLRVQVGH-GLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKH-I-A-G-VDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRLN----
27 PsiBlast_CBE 94.74100%-147 - C3 -3NBA COAD_MYCTU D:[21-176] MTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-GMFDLDERIAMVKESTTHLPNLRVQVGH-GLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKH-I-A-G-VDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRL-----
117 HHSearch 75.0348%-133 - C3 -1VLH COAD_THEMA A:[13-169] -MKAVYPGSFDPITLGHVDIIKRALSIFDELVVLVTENPRKK-CMFTLEERKKLIEEVLSDLDGVKVDVHH-GLLVDYLKKHGIKVLVRGLRAVTDYEYELQMALANKK-LYS-D-LETVFLIASEKFSFISSSLVKEVALYGGDVTEWVPPEVARALNEKLK----
87 PsiBlast_CBE 73.8139%-146 - C3 -3ND6 COAD_ENTFA A:[5-158] ---ALFPGSFDPMTNGHLNLIERSAKLFDEVIIGVFI-------LFTPEEKKYLIEEATKEMPNVRVIMQETQLTVESAKSLGANFLIRGIRNVKDYEYEKDIAKMNQH-L-APE-IETVFLLAEEPYAHVSSSLLKEVLRFGGDVSDYLPPNIYHALKQK------
113 HHSearch 73.7650%-133 - C3 -1OD6 COAD_THET8 A:[1-159] -MHVVYPGSFDPLTNGHLDVIQRASRLFEKVTVAVLEN----QYLFSAEERLAIIREATAHLANVEAATFS-GLLVDFVRRVGAQAIVKGLRAVSDYEYELQMAHLNRQ-LYP-G-LETLFILAATRYSFVSSTMVKEIARYGGDVSKLVPPATLRALKAKLG----
74 PsiBlast_CBE 73.5142%-138 - C3 -3K9W COAD_BURP1 A:[22-178] MVVAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRAKK-PFFSLEERLKIANEVLGHYPNVKVMGFT-GLLKDFVRANDARVIVRGLRAVSDFEYEFQMAGMNRYLL-P-D-VETMFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLTEKV-----
118 HHSearch 73.3042%-136 - C3 -3K9W COAD_BURP1 A:[22-179] MVVAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRAKK-PFFSLEERLKIANEVLGHYPNVKVMGFT-GLLKDFVRANDARVIVRGLRAVSDFEYEFQMAGMNRY-LLP-D-VETMFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLTEKVA----
124 HHSearch 73.1842%-138 - C3 -1O6B COAD_BACSU A:[2-162] ASIAVCPGSFDPVTYGHLDIIKRGAHIFEQVYVCVLNNSSKK-PLFSVEERCELLREVTKDIPNITVETSQ-GLLIDYARRKNAKAILRGLRAVSDFEYEMQGTSVNRV-LDE-S-IETFFMMANNQYSFLSSSIVKEVARYDGSVSEFVPPEVELALQQKFRQGG-
82 PsiBlast_CBE 73.1139%-144 - C3 -3ND6 COAD_ENTFA F:[5-158] ---ALFPGSFDPMTNGHLNLIERSAKLFDEVIIGVFI-------LFTPEEKKYLIEEATKEMPNVRVIMQETQLTVESAKSLGANFLIRGIRNVKDYEYEKDIAKMNQH-L-APE-IETVFLLAEEPYAHVSSSLLKEVLRFGGDVSDYLPPNIYHALKQK------
75 PsiBlast_CBE 72.3142%-139 - C3 -3PXU COAD_BURP1 A:[5-161] MVVAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRAKK-PFFSLEERLKIANEVLGHYPNVKVMGFT-GLLKDFVRANDARVIVRGLRA---FEYEFQMAGMNRYLL-P-D-VETMFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLTEKV-----
80 PsiBlast_CBE 71.8039%-141 - C3 -3ND7 COAD_ENTFA B:[5-158] ---ALFPGSFDPMTNGHLNLIERSAKLFDEVIIGVFI-------LFTPEEKKYLIEEATKEMPNVRVIMQETQLTVESAKSLGANFLIRGIRNVKDYEYEKDIAKMNQH-L-APE-IETVFLLAEEPYAHVSSSLLKEVLRFGGDVSDYLPPNIYHALKQK------
121 HHSearch 71.0944%-136 - C3 -4NAT COAD_STAAW A:[3-159] HTIAVIPGSFDPITYGHLDIIERSTDRFDEIHVCVL-------GTFSLEERMDLIEQSVKHLPNVKVHQFS-GLLVDYCEQVGAKTIIRGLRAVSDFEYELRLTSMNKK-LNN-E-IETLYMMSSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKKKF-----
70 PsiBlast_CBE 70.6140%-130 - C3 -3X1K ? A:[2-158] -NRVLYPGTFDPITKGHGDLIERASRLFDHVIIAVAASPKKN-PLFSLEQRVALAQEVTKHLPNVEVVGFS-TLLAHFVKEQKANVFLRGLRAVSDFEYEFQLANMNRQ-L-APD-VESMFLTPSEKYSFISSTLVREIAALGGDISKFVHPAVADALAERFK----
119 HHSearch 69.8841%-127 - C3 -4RUK ? A:[2-158] -NRVLYPGTFDPITKGHGDLIERASRLFDHVIIAVAASPKKN-PLFSLEQRVALAQEVTKHLPNVEVVGFS-TLLAHFVKEQKANVFLRGLRAVSDFEYEFQLANMNRQ-L-APD-VESMFLTPSEKYSFISSTLVREIAALGGDISKFVHPAVADALAERFK----
59 PsiBlast_CBE 69.2940%-129 - C3 -4RUK ? C:[1-158] MNRVLYPGTFDPITKGHGDLIERASRLFDHVIIAVAASPKKN-PLFSLEQRVALAQEVTKHLPNVEVVGFS-TLLAHFVKEQKANVFLRGLRAVSDFEYEFQLANMNRQ-L-APD-VESMFLTPSEKYSFISSTLVREIAALGGDISKFVHPAVADALAERFK----
71 PsiBlast_CBE 69.2840%-129 - C3 -3X1J ? C:[1-158] MNRVLYPGTFDPITKGHGDLIERASRLFDHVIIAVAASPKKN-PLFSLEQRVALAQEVTKHLPNVEVVGFS-TLLAHFVKEQKANVFLRGLRAVSDFEYEFQLANMNRQ-L-APD-VESMFLTPSEKYSFISSTLVREIAALGGDISKFVHPAVADALAERFK----
72 PsiBlast_CBE 69.1340%-126 - C3 -3X1J ? B:[1-158] MNRVLYPGTFDPITKGHGDLIERASRLFDHVIIAVAASPKKN-PLFSLEQRVALAQEVTKHLPNVEVVGFS-TLLAHFVKEQKANVFLRGLRAVSDFEYEFQLANMNRQ-L-APD-VESMFLTPSEKYSFISSTLVREIAALGGDISKFVHPAVADALAERFK----
69 PsiBlast_CBE 68.7640%-124 - C3 -3X1K ? B:[2-158] -NRVLYPGTFDPITKGHGDLIERASRLFDHVIIAVAASPKKN-PLFSLEQRVALAQEVTKHLPNVEVVGFS-TLLAHFVKEQKANVFLRGLRAVSDFEYEFQLANMNRQ-L-APD-VESMFLTPSEKYSFISSTLVREIAALGGDISKFVHPAVADALAERFK----
73 PsiBlast_CBE 68.0740%-124 - C3 -3X1J ? A:[1-158] MNRVLYPGTFDPITKGHGDLIERASRLFDHVIIAVAASPKKN-PLFSLEQRVALAQEVTKHLPNVEVVGFS-TLLAHFVKEQKANVFLRGLRAVSDFEYEFQLANMNRQ-L-APD-VESMFLTPSEKYSFISSTLVREIAALGGDISKFVHPAVADALAERFK----
94 PsiBlast_CBE 63.2335%-153 - C3 -3NV7 COAD_HELPY A:[6-150] ----IYPGTFDPVTNGHIDIIHRSSELFEKLIVAVAHSSAKN-PMFSLDERLKMIQLATKSFKNVECVAFE-GLLAYLAKEYHCKVLVRGLRVVSDFEYELQMGYANKS-L-N-HELETLYFMPTLQNAFISSSIVRSIIAHKGDASHLVPKEI-------------
125 HHSearch 62.2634%-143 - C3 -3NV7 COAD_HELPY A:[3-157] -KVGIYPGTFDPVTNGHIDIIHRSSELFEKLIVAVAHSSAKN-PMFSLDERLKMIQLATKSFKNVECVAFE-GLLAYLAKEYHCKVLVRGLRVVSDFEYELQMGYANKS-LNH-E-LETLYFMPTLQNAFISSSIVRSIIAHKGDASHLVPKEIYPLISKA------