@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Rv3053c: (2016-05-16 )
MTVTVYTKPACVQCSATSKALDKQGIAYQKVDISLDSEARDYVMALGYLQAPVVVAGNDHWSGFRPDRIKALAGAALTA

Atome Classification :

(20 SA) ---.........10.------..-.....20........30....-----.----..--.40...----.-.---...50-------------------------------------.......-.60........70........---
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) ---MTVTVYTKPACV------QC-SATSKALDKQGIAYQKVDISL-----D----SE--ARDYVM----A-L---GYLQA-------------------------------------PVVVAGN-DHWSGFRPDRIKALAGAALTA---
3 PsiBlast_PDB 97.18100%-122 - C4 -4K8M ? A:[1-78] ----TVTVYTKPACV------QC-SATSKALDKQGIAYQKVDISL-----D----SE--ARDYVM----A-L---GYLQA-------------------------------------PVVVAGN-DHWSGFRPDRIKALAGAALTA---
1 PsiBlast_PDB 95.91100%-118 - C4 -4HS1 ? A:[2-79] ----TVTVYTKPACV------QC-SATSKALDKQGIAYQKVDISL-----D----SE--ARDYVM----A-L---GYLQA-------------------------------------PVVVAGN-DHWSGFRPDRIKALAGAALTA---
26 HHSearch 95.69100%-123 - C4 -4K8M ? A:[1-76] ----TVTVYTKPACV------QC-SATSKALDKQGIAYQKVDISL-----D----SE--ARDYVM----A-L---GYLQA-------------------------------------PVVVAGN-DHWSGFRPDRIKALAGAAL-----
2 PsiBlast_PDB 93.49100%-112 - C4 -4F2I ? A:[1-78] ----TVTVYTKPACV------QC-SATSKALDKQGIAYQKVDISL-----D----SE--ARDYVM----A-L---GYLQA-------------------------------------P-VVAGN-DHWSGFRPDRIKALAGAALTA---
4 PsiBlast_PDB 84.4072%-118 - C4 -4FIW ? A:[2-76] ----AITVYTKPACV------QC-NATKKALDRAGLEYDLVDISL-----D----EE--AREYVL----A-L---GYLQA-------------------------------------PVVVADG-SHWSGFRPERIREMATAA------
45 Fugue 74.8142%-122 - C4 -1H75 - NRDH_ECOLI A:[1-76] ---MRITIYTRNDCV------QC-HATKRAMENRGFDFEMINVDR-----V----PE--AAEALR----A-Q---GFRQL-------------------------------------PVVIAGD-LSWSGFRPDMINRLHPAP------
25 HHSearch 74.5941%-122 - C4 -1H75 - NRDH_ECOLI A:[1-76] ---MRITIYTRNDCV------QC-HATKRAMENRGFDFEMINVDR-----V----PE--AAEALR----A-Q---GFRQL-------------------------------------PVVIAGD-LSWSGFRPDMINRLHPAP------
6 PsiBlast_PDB 74.5941%-122 - C4 -1H75 - NRDH_ECOLI A:[1-76] ---MRITIYTRNDCV------QC-HATKRAMENRGFDFEMINVDR-----V----PE--AAEALR----A-Q---GFRQL-------------------------------------PVVIAGD-LSWSGFRPDMINRLHPAP------
5 PsiBlast_PDB 73.3172%-116 - C4 -1R7H - ? A:[1-74] ---MSITLYTKPACV------QC-TATKKALDRAGLAYNTVDISL-----D----DE--ARDYVM----A-L---GYVQA-------------------------------------PVVEVDG-EHWSGFRPERIKQLQA--------
31 HHSearch 67.7025%-129 - C4 -3NZN ? A:[23-102] ----KVIMYGLSTCV------WC-KKTKKLLTDLGVDFDYVYVDRLEGKEE----EE--AVEEVR----RFN---PSVSF-------------------------------------PTTIINDEKAIVGFKEKEIRESLG--------
27 HHSearch 66.1424%-119 - C4 -3ZIT - ? A:[3-76] ----KIEVYAQPDCP------PC-VIVKEFLKHNNVAYEEFDVKK-----D----AA--ARNRLLY---D-Y---DSYST-------------------------------------PTVVIDG-EVVAGFQIEKLQQLLN--------
7 PsiBlast_PDB 65.1926%-122 - C4 -3ZIJ - ? A:[4-76] -----IEVYTQPDCP------PC-VIVKEFLKHNNVAYEEFDVKK-----D----AA--ARNRLLY---D-Y---DSYST-------------------------------------PTVVIDG-EVVAGFQIEKLQQLLN--------
8 PsiBlast_PDB 63.5625%-124 - C4 -3ZIT - ? A:[4-74] -----IEVYAQPDCP------PC-VIVKEFLKHNNVAYEEFDVKK-----D----AA--ARNRLLY---D-Y---DSYST-------------------------------------PTVVIDG-EVVAGFQIEKLQQL----------
23 PsiBlast_CBE 62.9031%-111 - C4 -4TR1 ? B:[3-72] ----NITIYTKNYCP------YS-KKAVSLLSSKGVDFKEVDVTH-----D----SK--AFEDVM----AKT---GWDTV-------------------------------------PQVFVDE-EFLGG---DDIHAL----------
46 Fugue 61.6326%-102 - C4 -2LQO - Y3198_MYCTU A:[1-88] MVTAALTIYTTSWCG------YC-LRLKTALTANRIAYDEVDIEH-----N----RA--AAEFVG----S-VNG-GNRTV-------------------------------------PTVKFADGSTLTNPSADEVKAKLVKIAGLEHH
51 Fugue 60.7326%-104 - C4 -1RW1 ? A:[1-114] ----TYVLYGIKAC-------DTMKKARTWLDEHKVAYDFHDYKA-----VGIDREH--LRRWCA----E-H---GWQTVLNRAGTTFRKLDEAQKADLDEAKAIELMLAQPSMIKRPVLELGG-RTLVGFKPDAYAAALA--------
29 HHSearch 60.6525%-117 - C4 -3IC4 ? A:[13-91] ----EVLMYGLSTCP------HC-KRTLEFLKREGVDFEVIWIDK-----L----EGEERKKVIEKVHSI-S---GSYSV-------------------------------------PVVVKGD-KHVLGYNEEKLKELIR--------
37 HHSearch 59.8527%-119 - C4 -2KHP - ? A:[7-70] ----DVIIYTRPGCP------YC-ARAKALLARKGAEFNEIDASA-----T----PE--LRAEMQE---R-S---GRNTF-------------------------------------PQIFIGS-VHVGGC------------------
43 HHSearch 59.6430%-124 - C4 -1T1V SH3L3_MOUSE A:[2-81] ---SGLRVYSTSVTGSREIKSQQ-SEVTRILDGKRIQYQLVDISQ-----D----NA--LRDEMR----T-LAGNPKATP-------------------------------------PQIVNGN-HYCGDY--ELFVEAV---------
21 PsiBlast_CBE 59.4433% -95 - C4 -4TR0 ? B:[3-72] ----NITIYTKNYCP------YC-KKAVSLLSSKGVDFKEVDVTH-----D----SK--AFEDVM----AKT---GWDTV-------------------------------------PQVFVDE-EFLGGC--DDIHAL----------