@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Rv3303c: (2016-05-18 )
MVTRIVILGGGPAGYEAALVAATSHPETTQVTVIDCDGIGGAAVLDDCVPSKTFIASTGLRTELRRAPHLGFHIDFDDAKISLPQIHARVKTLAAAQSADITAQLLSMGVQVIAGRGELIDSTPGLARHRIKATAADGSTSEHEADVVLVATGASPRILPSAQPDGERILTWRQLYDLDALPDHLIVVGSGVTGAEFVDAYTELGVPVTVVASQDHVLPYEDADAALVLEESFAERGVRLFKNARAASVTRTGAGVLVTMTDGRTVEGSHALMTIGSVPNTSGLGLERVGIQLGRGNYLTVDRVSRTLATGIYAAGDCTGLLPLASVAAMQGRIAMYHALGEGVSPIRLRTVAATVFTRPEIAAVGVPQSVIDAGSVAARTIMLPLRTNARAKMSEMRHGFVKIFCRRSTGVVIGGVVVAPIASELILPIAVAVQNRITVNELAQTLAVYPSLSGSITEAARRLMAHDDLDCTAAQDAAEQLALVPHHLPTSN

Atome Classification :

(20 SA) .........10........20........30......-..40........50........60--......-..---.70........80........90........100.......110.......120.......130...--------....140.......150.......160..--.....170......-.180.......190.......200.......210.......-220........230...-....240.......250.-..---...--.260---.-----.----.---....---..270---------........280.......290.......300.......310.......320........330.......340..-......350.......360....-...370...--....380.......390.......400.......410.......420.......430.......440.......450.......460.......470.......480.......490.
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MVTRIVILGGGPAGYEAALVAATSHPETTQVTVIDCD-GIGGAAVLDDCVPSKTFIASTGL---RTELRR-AP---HLGFHIDFDDAKISLPQIHARVKTLAAAQSADITAQLLSMGVQVIAGRGELIDSTPGLARHRIKATA--------ADGSTSEHEADVVLVATGASPRILPSAQP--DGERILTWRQLYDL-DALPDHLIVVGSGVTGAEFVDAYTELGVPVTVVASQDHVLP-YE-DADAALVLEESFAE-RGVRLFKNARAASVTRTG-AG---VLV--TM-----T-----D----G---RTVE---GSHA----------LMTIGSVPNTSGLGLERVGIQLGRGNYLTVDRVSRTLATGIYAAGDCTGL-LPLASVAAMQGRIAMYHALG-EG-VSPIRLRTVAATVFTRPEIAAVG-VPQSVIDAG--SVAARTIMLPLRTNARAKMSEMRHGFVKIFCRRSTGVVIGGVVVAPIASELILPIAVAVQNRITVNELAQTLAVYPSLSGSITEAARRLMAHDDLDCTAAQDAAEQLALVPHHLPTSN
31 HHSearch 98.96100%-131 - C1 -1XDI LPDA_MYCTU A:[2-466] -VTRIVILGGGPAGYEAALVAATSHPETTQVTVIDCD-GIGGAAVLDDCVPSKTFIASTGL---RTELRR-AP---HLGFH------KISLPQIHARVKTLAAAQSADITAQLLSMGVQVIAGRGELIDSTPGLARHRIKATA--------ADGSTSEHEADVVLVATGASPRILPSAQP--DGERILTWRQLYDL-DALPDHLIVVGSGVTGAEFVDAYTELGVPVTVVASQDHVLP-YE-DADAALVLEESFAE-RGVRLFKNARAASVTRTG-AG---VLV--TM-----T-----D----G---RTVE---GSHA----------LMTIGSVPNTSGLGLERVGIQLGRGNYLTVDRVSRTLATGIYAAGDCTGL-LPLASVAAMQGRIAMYHALG-EG-VSPIRLRTVAATVFTRPEIAAVG-VPQSVIDAG--SVAARTIMLPLRTNARAKMSEMRHGFVKIFCRRSTGVVIGGVVVAPIASELILPIAVAVQNRITVNELAQTLAVYPSLSGSITEAARRLMA---------------------------
1 PsiBlast_PDB 98.96100%-131 - C1 -1XDI LPDA_MYCTU A:[2-466] -VTRIVILGGGPAGYEAALVAATSHPETTQVTVIDCD-GIGGAAVLDDCVPSKTFIASTGL---RTELRR-AP---HLGFH------KISLPQIHARVKTLAAAQSADITAQLLSMGVQVIAGRGELIDSTPGLARHRIKATA--------ADGSTSEHEADVVLVATGASPRILPSAQP--DGERILTWRQLYDL-DALPDHLIVVGSGVTGAEFVDAYTELGVPVTVVASQDHVLP-YE-DADAALVLEESFAE-RGVRLFKNARAASVTRTG-AG---VLV--TM-----T-----D----G---RTVE---GSHA----------LMTIGSVPNTSGLGLERVGIQLGRGNYLTVDRVSRTLATGIYAAGDCTGL-LPLASVAAMQGRIAMYHALG-EG-VSPIRLRTVAATVFTRPEIAAVG-VPQSVIDAG--SVAARTIMLPLRTNARAKMSEMRHGFVKIFCRRSTGVVIGGVVVAPIASELILPIAVAVQNRITVNELAQTLAVYPSLSGSITEAARRLMA---------------------------
21 PsiBlast_CBE 98.01100%-134 - C1 -1XDI LPDA_MYCTU B:[2-466] -VTRIVILGGGPAGYEAALVAATSHPETTQVTVIDCD-GIGGAAVLDDCVPSKTFIASTGL---RTELRR-AP---HLGFH------KISLPQIHARVKTLAAAQSADITAQLLSMGVQVIAGRGELIDSTPGLARHRIKATA--------ADGSTSEHEADVVLVATGASPRILPSAQP--DGERILTWRQLYDL-DALPDHLIVVGSGVTGAEFVDAYTELGVPVTVVASQDHVLP-YE-DADAALVLEESFAE-RGVRLFKNARAASVTRTG-AG---VLV--TM-----T-----D----G---RTVE---GSHA----------LMTIGSVPNTSGLGLERVGIQLGRGNYLTVDRVSRTLATGIYAAGDCTGL-LPLASVAAMQGRIAMYHALG-EG-VSPIRLRTVAATVFTRPEIAAVG-VPQSVIDAG--SVAARTIMLPLRTNARAKMSEMRHGFVKIFCRRSTGVVIGGVVVAPIASELILPIAVAVQNRITVNELAQTLAVYPSLSGSITEAARRLMA---------------------------
41 HHSearch 69.6327%-113 * C1 *3URH ? A:[26-486] --YDLIVIGSGPGGYVCAIKAAQL---GMKVAVVEKRSTYGGTCLNVGCIPSKALLHASEM---FHQAQHGLE---ALGVEV--ANPKLNLQKMMAHKDATVKSNVDGVSFLFKKNKIDGFQGTGKVLGQG------KVSVTN--------EKGEEQVLEAKNVVIATGSDVAGIPGVEVAFDEKTIVSSTGALAL-EKVPASMIVVGGGVIGLELGSVWARLGAKVTVVEFLDTILG-GM-DGEVAKQLQRMLTK-QGIDFKLGAKVTGAVKSG-DG---AKV--TF-----EPVKGGE----A---TTLD---AEVV----------LIATGRKPSTDGLGLAKAGVVLDSRGRVEIDRHFQTSIAGVYAIGDVVRG-PMLAHKAEDEGVAVAEIIAG-QA--GHVNYDVIPGVVYTQPEVASVG-KTEEELKAA--GVAYKIGKFPFTANGRARAMLQTDGFVKILADKETDRVLGGHIIGFGAGEMIHEIAVLMEFGGSSEDLGRTCHAHPTMSEAVKEAALSTFF---------------------------
49 HHSearch 67.2125%-110 - C1 -1ZMD DLDH_HUMAN A:[5-467] IDADVTVIGSGPGGYVAAIKAAQL---GFKTVCIEKNETLGGTCLNVGCIPSKALLNNSHY---YHMAHG-TDFA-SRGI--EMSEVRLNLDKMMEQKSTAVKALTGGIAHLFKQNKVVHVNGYGKITG------KNQVTATK--------ADGGTQVIDTKNILIATGSEVTPFPGITI--DEDTIVSSTGALSL-KKVPEKMVVIGAGVIGVELGSVWQRLGADVTAVEFLGHVGGVGI-DMEISKNFQRILQK-QGFKFKLNTKVTGATKKSDGK---IDV--SIEA---A-----S----GGKAEVIT---CDVL----------LVCIGRRPFTKNLGLEELGIELDPRGRIPVNTRFQTKIPNIYAIGDVVAG-PMLAHKAEDEGIICVEGMAG-GA--VHIDYNCVPSVIYTHPEVAWVG-KSEEQLKEE--GIEYKVGKFPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHILGPGAGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAAS----------------------------
2 PsiBlast_PDB 66.1827%-114 - C1 -1EBD DLDH1_GEOSE A:[4-452] --TETLVVGAGPGGYVAAIRAAQLG---QKVTIVEKG-NLGGVCLNVGCIPSKALISASHR---YEQAKH-SE---EMG--IKAENVTIDFAKVQEWKASVVKKLTGGVEGLLKGNKVEIVKGEAYFVDA------NTVRVVN--------GD-SAQTYTFKNAIIATGSRPIELPNFKF--S-NRILDSTGALNL-GEVPKSLVVIGGGYIGIELGTAYANFGTKVTILEGAGEILS-GF-EKQMAAIIKKRLKK-KGVEVVTNALAKGAEERE-DG---VTV--TY-----EANG--E----T---KTID---ADYV----------LVTVGRRPNTDELGLEQIGIKMTNRGLIEVDQQCRTSVPNIFAIGDIVPG-PALAHKASYEGKVAA-EAIA-GH-PSAVDYVAIPAVVFSDPECASVGYFEQQAKDEGIDVIAAK---FPFAANGRALALNDTDGFLKLVVRKEDGVIIGAQIIGPNASDMIAELGLAIEAGMTAEDIALTIHAHPTLGEIAMEAAE-------------------------------
50 HHSearch 65.4827%-111 - C1 -2YQU ? A:[1-451] -MYDLLVIGAGPGGYVAAIRAAQL---GMKVGVVEKEKALGGTCLRVGCIPSKALLETTER---IYEAKK-G----LLGAK--VKGVELDLPALMAHKDKVVQANTQGVEFLFKKNGIARHQGTARFLSER------KVLV-----------EETGEELEARYILIATGSAPLIPPWAQV--DYERVVTSTEALSF-PEVPKRLIVVGGGVIGLELGVVWHRLGAEVIVLEYMDRILP-TM-DLEVSRAAERVFKK-QGLTIRTGVRVTAVVPEA-KG---ARV--EL-----E-----G----G---EVLE---ADRV----------LVAVGRRPYTEGLSLENAGLSTDERGRIPVDEHLRTRVPHIYAIGDVVRG-PMLAHKASEEGIAAVEHMVR-GF--GHVDYQAIPSVVYTHPEIAAVG-YTEEELKAQ--GIPYKVGKFPYSASGRARAMGETEGFIKVLAHAKTDRILGVHGIGARVGDVLAEAALALFFKASAEDLGRAPHAHPSLSEILKEAALAAWER--------------------------
43 HHSearch 65.0425%-111 - C1 -4JQ9 ? A:[6-461] -KTQVVVLGAGPAGYSAAFRCADL---GLETVIVERYNTLGGVCLNVGCIPSKALLHVAKV---IEEAKA-LA---EHGIV--FGEPKTDIDKIRTWKEKVINQLTGGLAGMAKGRKVKVVNGLGKFTGA------NTLEVEG--------E-NGKTVINFDNAIIAAGSRPIQLPFIPH--EDPRIWDSTDALEL-KEVPERLLVMGGGIIGLEMGTVYHALGSQIDVVEMFDQVIP-AA-DKDIVKVFTKRISK--KFNLMLETKVTAVEAKE-DG---IYV--TM-----E-----GKKAPA---EPQR---YDAV----------LVAIGRVPNGKNLDAGKAGVEVDDRGFIRVDKQLRTNVPHIFAIGDIVGQ-PMLAHKGVHEGHVAAEVIAG-KK--HYFDPKVIPSIAYTEPEVAWVG-LTEKEAKEK--GISYETATFPWAASGRAIASDCADGMTKLIFDKESHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEVFEG---------------------------
44 HHSearch 64.9027%-109 - C1 -2EQ6 ? A:[5-458] KTYDLIVIGTGPGGYHAAIRAAQL---GLKVLAVEAG-EVGGVCLNVGCIPTKALLHAAET---LHHLKV-AE---GFGLKA---KPELDLKKLGGWRDQVVKKLTGGVGTLLKGNGVELLRGFARLVGPK------EVEV-------------GGERYGAKSLILATGSEPLELKGFPF---GEDVWDSTRALKVEEGLPKRLLVIGGGAVGLELGQVYRRLGAEVTLIEYMPEILP-QG-DPETAALLRRALEK-EGIRVRTKTKAVGYEKKK-DG---LHV--RLEPAEGG-----E----G---EEVV---VDKV----------LVAVGRKPRTEGLGLEKAGVKVDERGFIRVNARMETSVPGVYAIGDAARP-PLLAHKAMREGLIAAENAAG-KD--SAFDY-QVPSVVYTSPEWAGVG-LTEEEAKRA--GYKVKVGKFPLAASGRALTLGGAEGMVKVVGDEETDLLLGVFIVGPQAGELIAEAALALEMGATLTDLALTVHPHPTLSESLMEAAEAFHKQA-------------------------
47 HHSearch 64.0228%-109 - C1 -2A8X DLDH_MYCTU A:[2-460] THYDVVVLGAGPGGYVAAIRAAQL---GLSTAIVEPK-YWGGVCLNVGCIPSKALLRNAEL---VHIFTKDAK---AFGIS---GEVTFDYGIAYDRSRKVAEGRVAGVHFLMKKNKITEIHGYGTFADAN------TLLVDL--------NDGGTESVTFDNAIIATGSSTRLVPGTSL---SANVVTYEEQILS-RELPKSIIIAGAGAIGMEFGYVLKNYGVDVTIVEFLPRALP-NE-DADVSKEIEKQFKK-LGVTILTATKVESIADGG-SQ---VTV--TVT----K-----D----GVA-QELK---AEKV----------LQAIGFAPNVEGYGLDKAGVALTDRKAIGVDDYMRTNVGHIYAIGDVNGL-LQLAHVAEAQGVVAAETIAG-AETLTLGDHRMLPRATFCQPNVASFG-LTEQQARNE--GYDVVVAKFPFTANAKAHGVGDPSGFVKLVADAKHGELLGGHLVGHDVAELLPELTLAQRWDLTASELARNVHTHPTMSEALQECFHGLVGH--------------------------
37 HHSearch 61.8925%-105 - C1 -1OJT ? A:[6-473] -EYDVVVLGGGPGGYSAAFAAADE---GLKVAIVERYKTLGGVCLNVGCIPSKALLHNAAV---IDEVRH-LA---ANGIKY--PEPELDIDMLRAYKDGVVSRLTGGLAGMAKSRKVDVIQGDGQFLDPH----HLEVSLTAGDAYEQAAPTGEKKIVAFKNCIIAAGSRVTKLPFIPE--D-PRIIDSSGALAL-KEVPGKLLIIGGGIIGLEMGTVYSTLGSRLDVVEMMDGLMQ-GA-DRDLVKVWQKQNEY-RFDNIMVNTKTVAVEPKE-DG---VYV--TF-----E-----GANAPK---EPQR---YDAV----------LVAAGRAPNGKLISAEKAGVAVTDRGFIEVDKQMRTNVPHIYAIGDIVGQ-PMLAHKAVHEGHVAAENCAG-HK--AYFDARVIPGVAYTSPEVAWVG-ETELSAKAS--ARKITKANFPWAASGRAIANGCDKPFTKLIFDAETGRIIGGGIVGPNGGDMIGEVCLAIEMGCDAADIGKTIHPHPTLGESIGMAAEVALGT--------------------------
15 PsiBlast_PDB 61.7825%-110 - C1 -2F5Z DLDH_HUMAN A:[9-462] ----VTVIGSGPGGYVAAIKAAQLGFKT--VCIEKNE-TLGGTCLNVGCIPSKALLNNSHY---YHMAHG-TD---FASRGIEMSEVRLNLDKMMEQKSTAVKALTGGIAHLFKQNKVVHVNGYGKIT------GKNQVTATK--------ADGGTQVIDTKNILIATGSEVTPFPGITI--DEDTIVSSTGALSL-KKVPEKMVVIGAGVIGVELGSVWQRLGADVTAVEFLGHVGG-VGIDMEISKNFQRILQK-QGFKFKLNTKVTGATKKS-DGKIDVSI--EA-----A-----S----G---GKAEVITCDVL----------LVCIGRRPFTKNLGLEELGIELDPRGRIPVNTRFQTKIPNIYAIGDVVAG-PMLAHKAEDEGIICV-EGMA-GG-AVHIDYNCVPSVIYTHPEVAWVG-KSEEQLKEE--GIEYKVGKFPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHILGPGAGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREA---------------------------------
34 HHSearch 61.0224%-109 - C1 -2QAE DLDH_TRYCR A:[1-463] NPYDVVVIGGGPGGYVASIKAAQL---GMKTACVEKRGALGGTCLNVGCIPSKALLHATHL---YHDAHANFA---RYGLMG-GEGVTMDSAKMQQQKERAVKGLTGGVEYLFKKNKVTYYKGEGSFETA------HSIRVNG--------LDGKQEMLETKKTIIATGSEPTELPFLPF--DEKVVLSSTGALAL-PRVPKTMVVIGGGVIGLELGSVWARLGAEVTVVEFAPRCAP-TL-DEDVTNALVGALAKNEKMKFMTSTKVVGGTNNG-DS---VSLEVEG-----K-----------R--ETVT---CEAL----------LVSVGRRPFTGGLGLDKINVAKNERGFVKIGDHFETSIPDVYAIGDVVDKGPMLAHKAEDEGVACAEILAG-KP--GHVNYGVIPAVIYTMPEVASVG-KSEDELKKE--GVAYKVGKFPFNANSRAKAVSTEDGFVKVLVDKATDRILGVHIVCTTAGELIGEACLAMEYGASSEDVGRTCHAHPTMSEALKEACMALFA---------------------------
8 PsiBlast_PDB 60.2928%-105 - C1 -3II4 DLDH_MYCTU A:[8-462] ----VVVLGAGPGGYVAAIRAAQLGLSTA---IVEPK-YWGGVCLNVGCIPSKALLRNAELVHIFTKDAK-AF---GISGEVTFD-----YGIAYDRSRKVAEGRVAGVHFLMKKNKITEIHGYGTFADANTLLV------DL--------NDGGTESVTFDNAIIATGSSTRLVPGTSL--SA-NVVTYEEQILS-RELPKSIIIAGAGAIGMEFGYVLKNYGVDVTIVEFLPRALP-NE-DADVSKEIEKQFKK-LGVTILTATKVESIADGG-SQ---VTV--TV-----TK----D----GVA-QELK---AEKV----------LQAIGFAPNVEGYGLDKAGVALTDRKAIGVDDYMRTNVGHIYAIGDVNGL-LQLAHVAEAQGVVAAETIAGAET-LTLGDHRMLPRATFCQPNVASFG-LTEQQARNE--GYDVVVAKFPFTANAKAHGVGDPSGFVKLVADAKHGELLGGHLVGHDVAELLPELTLAQRWDLTASELARNVHTHPTMSEALQECFHGLVGH--------------------------
18 PsiBlast_PDB 60.2125%-106 - C1 -4JQ9 ? A:[7-457] --TQVVVLGAGPAGYSAAFRCADLGLET--VIVERYN-TLGGVCLNVGCIPSKALLHVAKV---IEEAKA-LA---EHG--IVFGEPKTDIDKIRTWKEKVINQLTGGLAGMAKGRKVKVVNGLGKFTGA------NTLEVEG--------ENGKTVIN-FDNAIIAAGSRPIQLPFIPH--EDPRIWDSTDALEL-KEVPERLLVMGGGIIGLEMGTVYHALGSQIDVVEMFDQVIP-AA-DKDIVKVFTKRISK-K-FNLMLETKVTAVEAKE-DG---IYV--TM-----------------------E---GKKAPAEPQRYDAVLVAIGRVPNGKNLDAGKAGVEVDDRGFIRVDKQLRTNVPHIFAIGDIVGQ-PMLAHKGVHEGHVAAEVIAG-KK--HYFDPKVIPSIAYTEPEVAWVG-LTEKEAKEK--GISYETATFPWAASGRAIASDCADGMTKLIFDKESHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAE-------------------------------
17 PsiBlast_PDB 60.1725%-109 - C1 -4JDR DLDH_ECOLI A:[7-457] --TQVVVLGAGPAGYSAAFRCADLGLET--VIVERYN-TLGGVCLNVGCIPSKALLHVAKV---IEEAKA-LA---EHG--IVFGEPKTDIDKIRTWKEKVINQLTGGLAGMAKGRKVKVVNGLGKFTGA------NTLEVEG--------ENGKTVIN-FDNAIIAAGSRPIQLPFIPH--EDPRIWDSTDALEL-KEVPERLLVMGGGIIGLEMGTVYHALGSQIDVVEMFDQVIP-AA-DKDIVKVFTKRISK-K-FNLMLETKVTAVEAKE-DG---IYV--TM-----------------------E---GKKAPAEPQRYDAVLVAIGRVPNGKNLDAGKAGVEVDDRGFIRVDKQLRTNVPHIFAIGDIVGQ-PMLAHKGVHEGHVAAEVIAG-KK--HYFDPKVIPSIAYTEPEVAWVG-LTEKEAKEK--GISYETATFPWAASGRAIASDCADGMTKLIFDKESHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAE-------------------------------