@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Rv3318: (2016-05-18 )
MICQHRYDVVIVGAGGAGMRAAVEAGPRVRTAVLTKLYPTRSHTGAAQGGMCAALANVEDDNWEWHTFDTVKGGDYLADQDAVEIMCKEAIDAVLDLEKMGMPFNRTPEGRIDQRRFGGHTRDHGKAPVRRACYAADRTGHMILQTLYQNCVKHDVEFFNEFYALDLALTQTPSGPVATGVIAYELATGDIHVFHAKAVVIATGGSGRMYKTTSNAHTLTGDGIGIVFRKGLPLEDMEFHQFHPTGLAGLGILISEAVRGEGGRLLNGEGERFMERYAPTIVDLAPRDIVARSMVLEVLEGRGAGPLKDYVYIDVRHLGEEVLEAKLPDITEFARTYLGVDPVTELVPVYPTCHYLMGGIPTTVTGQVLRDNTSVVPGLYAAGECACVSVHGANRLGTNSLLDINVFGRRAGIAAASYAQGHDFVDMPPNPEAMVVGWVSDILSEHGNERVADIRGALQQSMDNNAAVFRTEETLKQALTDIHALKERYSRITVHDKGKRFNTDLLEAIELGFLLELAEVTVVGALNRKESRGGHAREDYPNRDDVNYMRHTMAYKEIGADKEGPELRSDVRLDFKPVVQTRYEPKERKY

Atome Classification :

(49 SA) .........10........20.......-.-30........40........50........60........70........80........90........100.......110.......120....-.-..-130.......140.......150.......160.......170.......180.......190.......200.......210.......220.......230.......240.......250.......260.......270.......280.......290.......300..-.-....310.......320.......330.......340.......350.......360.......---370---..----.----.....380.......390.......400.......410.-......420..-..-...-.430.......440.......450.......460.......470.......480.......490.......500.......510.......520.......530.......540.-..-----------------....----------------550.......560.......570--.......--------580.......590
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MICQHRYDVVIVGAGGAGMRAAVEAGPR-V-RTAVLTKLYPTRSHTGAAQGGMCAALANVEDDNWEWHTFDTVKGGDYLADQDAVEIMCKEAIDAVLDLEKMGMPFNRTPEGRIDQRRFGGHTRDHGK-A-PV-RRACYAADRTGHMILQTLYQNCVKHDVEFFNEFYALDLALTQTPSGPVATGVIAYELATGDIHVFHAKAVVIATGGSGRMYKTTSNAHTLTGDGIGIVFRKGLPLEDMEFHQFHPTGLAGLGILISEAVRGEGGRLLNGEGERFMERYAPTIVDLAPRDIVARSMVLEVLEGRGA-G-PLKDYVYIDVRHLGEEVLEAKLPDITEFARTYLGVDPVTELVPVYPTCHYLMGGIPTTVTGQVL---RD----NT----S----VVPGLYAAGECACVSVHGANRLGTNSLLDINVFGRRAGI-AAASYAQ-GHD-FV-DMP-PNPEAMVVGWVSDILSEHGNERVADIRGALQQSMDNNAAVFRTEETLKQALTDIHALKERYSRITVHDKGKRFNTDLLEAIELGFLLELAEVTVVGALNRKESRGGHAREDYPNR-DD-----------------VNYM----------------RHTMAYKEIGADKEGPELRSDVR--LDFKPVV--------QTRYEPKERKY
102 HHSearch 96.0849% -77 - C2 -2H88 SDHA_CHICK A:[14-621] -VVDHEFDAVVVGAGGAGLRAAFGLSEA-GFNTACVTKLFPTRSHTVAAQGGINAALGNMEDDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVIELENYGMPFSRTEEGKIYQRAFGGQSLQFGKGG-QA-HRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENG----ECRGVIALCIEDGTIHRFRAKNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTGIYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTIEIREGRGC-G-PEKDHVYLQLHHLPPQQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQVI---THVNG-ED----K----VVPGLYACGEAASASVHGANRLGANSLLDLVVFGRACAL-TIAETCK-PGEPVP-SIK-PNAGEESVANLDKLRFADGTIRTSEARLNMQKTMQSHAAVFRTGSILQEGCEKLSQIYRDLAHLKTFDRGIVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKLR-IDEFDYSKPLQGQQKRPFEEHWR----------------KHTLSYVDV--K-SG-----KVT--LKYRPVIDRTLNEEDCSSVPPAIRSY
63 PsiBlast_CBE 95.1544% -80 - C2 -4YT0 ? E:[37-634] -VIDHAYDVVIIGAGGAGLRAAMGLGEAGF-KTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGK-G-GVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGR----CVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGV-G-PEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVI---KY----TKEGGDK----IVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSI-NIKEELK-PDE-KIPELP-EGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLFKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKR-EDEYDYSKPIEGQTKRPFEKHWR----------------KHTLT-------KQDPRT-GHIT--LDYRPVI--------DKTLDPAE---
65 PsiBlast_CBE 94.9544% -77 - C2 -4YSZ ? E:[37-634] -VIDHAYDVVIIGAGGAGLRAAMGLGEAGF-KTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGK-G-GVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGR----CVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGV-G-PEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVI---KY----TKEGGDK----IVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSI-NIKEELK-PDE-KIPELP-EGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLFKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKR-EDEYDYSKPIEGQTKRPFEKHWR----------------KHTLT-------KQDPRT-GHIT--LDYRPVI--------DKTLDPAE---
103 HHSearch 94.9048% -73 - C2 -2WDQ SDHA_ECOLI A:[3-588] -LPVREFDAVVIGAGGAGMRAALQISQS-GQTCALLSKVFPTRSHTVSAQGGITVALGNTHEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILELEHMGLPFSRLDDGRIYQRPFGGQSKNFGG-E-QA-ARTAAAADRTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNQD--G-AVVGCTALCIETGEVVYFKARATVLATGGAGRIYQSTTNAHINTGDGVGMAIRAGVPVQDMEMWQFHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAKDLAGRDVVARSIMIEIREGRGC-DGPWGPHAKLKLDHLGKEVLESRLPGILELSRTFAHVDPVKEPIPVIPTCHYMMGGIPTKVTGQAL---TVNEKGED----V----VVPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGL-HLQESIA-EQG-ALRDAS-ESDVEASLDRLNRWNNNRNGEDPVAIRKALQECMQHNFSVFREGDAMAKGLEQLKVIRERLKNARLDDTSSEFNTQRVECLELDNLMETAYATAVSANFRTESRGAHSRFDFPDR-DD-----------------ENWL----------------CHSLYLPESE-SMTR------RS--VNMEPKL--------RPAFPPKIRTY
58 PsiBlast_CBE 94.8844% -75 - C2 -5C2T ? A:[37-634] -VIDHAYDVVIIGAGGAGLRAAMGLGEAGF-KTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGK-G-GVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGR----CVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGV-G-PEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVI---KY----TKEGGDK----IVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSI-NIKEELK-PDE-KIPELP-EGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLFKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKR-EDEYDYSKPIEGQTKRPFEKHWR----------------KHTLT-------KQDPRT-GHIT--LDYRPVI--------DKTLDPAE---
68 PsiBlast_CBE 94.6844% -77 - C2 -4YSY ? A:[37-634] -VIDHAYDVVIIGAGGAGLRAAMGLGEAGF-KTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGK-G-GVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGR----CVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGV-G-PEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVI---KY----TKEGGDK----IVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSI-NIKEELK-PDE-KIPELP-EGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLFKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKR-EDEYDYSKPIEGQTKRPFEKHWR----------------KHTLT-------KQDPRT-GHIT--LDYRPVI--------DKTLDPAE---
59 PsiBlast_CBE 94.6644% -74 - C2 -4YTN ? E:[37-634] -VIDHAYDVVIIGAGGAGLRAAMGLGEAGF-KTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGK-G-GVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGR----CVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGV-G-PEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVI---KY----TKEGGDK----IVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSI-NIKEELK-PDE-KIPELP-EGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLFKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKR-EDEYDYSKPIEGQTKRPFEKHWR----------------KHTLT-------KQDPRT-GHIT--LDYRPVI--------DKTLDPAE---
70 PsiBlast_CBE 94.6344% -77 - C2 -4YSX ? A:[37-634] -VIDHAYDVVIIGAGGAGLRAAMGLGEAGF-KTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGK-G-GVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGR----CVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGV-G-PEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVI---KY----TKEGGDK----IVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSI-NIKEELK-PDE-KIPELP-EGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLFKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKR-EDEYDYSKPIEGQTKRPFEKHWR----------------KHTLT-------KQDPRT-GHIT--LDYRPVI--------DKTLDPAE---
57 PsiBlast_CBE 94.5844% -79 - C2 -5C2T ? E:[37-634] -VIDHAYDVVIIGAGGAGLRAAMGLGEAGF-KTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGK-G-GVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGR----CVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGV-G-PEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVI---KY----TKEGGDK----IVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSI-NIKEELK-PDE-KIPELP-EGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLFKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKR-EDEYDYSKPIEGQTKRPFEKHWR----------------KHTLT-------KQDPRT-GHIT--LDYRPVI--------DKTLDPAE---
61 PsiBlast_CBE 94.5744% -75 * C2 *4YTM ? E:[37-634] -VIDHAYDVVIIGAGGAGLRAAMGLGEAGF-KTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGK-G-GVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGR----CVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGV-G-PEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVI---KY----TKEGGDK----IVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSI-NIKEELK-PDE-KIPELP-EGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLFKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKR-EDEYDYSKPIEGQTKRPFEKHWR----------------KHTLT-------KQDPRT-GHIT--LDYRPVI--------DKTLDPAE---
67 PsiBlast_CBE 94.5044% -77 - C2 -4YSY ? E:[37-634] -VIDHAYDVVIIGAGGAGLRAAMGLGEAGF-KTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGK-G-GVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGR----CVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGV-G-PEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVI---KY----TKEGGDK----IVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSI-NIKEELK-PDE-KIPELP-EGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLFKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKR-EDEYDYSKPIEGQTKRPFEKHWR----------------KHTLT-------KQDPRT-GHIT--LDYRPVI--------DKTLDPAE---
64 PsiBlast_CBE 94.4944% -79 - C2 -4YT0 ? A:[37-634] -VIDHAYDVVIIGAGGAGLRAAMGLGEAGF-KTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGK-G-GVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGR----CVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGV-G-PEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVI---KY----TKEGGDK----IVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSI-NIKEELK-PDE-KIPELP-EGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLFKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKR-EDEYDYSKPIEGQTKRPFEKHWR----------------KHTLT-------KQDPRT-GHIT--LDYRPVI--------DKTLDPAE---
60 PsiBlast_CBE 94.4244% -77 - C2 -4YTN ? A:[37-634] -VIDHAYDVVIIGAGGAGLRAAMGLGEAGF-KTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGK-G-GVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGR----CVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGV-G-PEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVI---KY----TKEGGDK----IVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSI-NIKEELK-PDE-KIPELP-EGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLFKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKR-EDEYDYSKPIEGQTKRPFEKHWR----------------KHTLT-------KQDPRT-GHIT--LDYRPVI--------DKTLDPAE---
69 PsiBlast_CBE 94.3844% -75 - C2 -4YSX ? E:[37-634] -VIDHAYDVVIIGAGGAGLRAAMGLGEAGF-KTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGK-G-GVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGR----CVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGV-G-PEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVI---KY----TKEGGDK----IVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSI-NIKEELK-PDE-KIPELP-EGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLFKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKR-EDEYDYSKPIEGQTKRPFEKHWR----------------KHTLT-------KQDPRT-GHIT--LDYRPVI--------DKTLDPAE---
77 PsiBlast_CBE 94.3644% -74 - C2 -3VR8 ? E:[37-634] -VIDHAYDVVIIGAGGAGLRAAMGLGEAGF-KTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTAKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGK-G-GVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGR----CVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGV-G-PEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVI---KY----TKEGGDK----IVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSI-NIKEELK-PDE-KIPELP-EGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLSKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKR-EDEYDYSKPIEGQTKRPFEKHWR----------------KHTLT-------KQDPRT-GHIT--LDYRPVI--------DKTLDPAE---
76 PsiBlast_CBE 94.3244% -77 - C2 -3VR9 ? A:[37-634] -VIDHAYDVVIIGAGGAGLRAAMGLGEAGF-KTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTAKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGK-G-GVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGR----CVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGV-G-PEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVI---KY----TKEGGDK----IVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSI-NIKEELK-PDE-KIPELP-EGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLSKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKR-EDEYDYSKPIEGQTKRPFEKHWR----------------KHTLT-------KQDPRT-GHIT--LDYRPVI--------DKTLDPAE---
75 PsiBlast_CBE 94.2044% -76 - C2 -3VR9 ? E:[37-634] -VIDHAYDVVIIGAGGAGLRAAMGLGEAGF-KTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTAKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGK-G-GVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGR----CVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGV-G-PEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVI---KY----TKEGGDK----IVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSI-NIKEELK-PDE-KIPELP-EGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLSKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKR-EDEYDYSKPIEGQTKRPFEKHWR----------------KHTLT-------KQDPRT-GHIT--LDYRPVI--------DKTLDPAE---
73 PsiBlast_CBE 94.1444% -77 - C2 -3VRA ? E:[37-634] -VIDHAYDVVIIGAGGAGLRAAMGLGEAGF-KTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTAKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGK-G-GVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGR----CVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGV-G-PEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVI---KY----TKEGGDK----IVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSI-NIKEELK-PDE-KIPELP-EGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLSKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKR-EDEYDYSKPIEGQTKRPFEKHWR----------------KHTLT-------KQDPRT-GHIT--LDYRPVI--------DKTLDPAE---
72 PsiBlast_CBE 94.1144% -77 - C2 -3VRB ? A:[37-634] -VIDHAYDVVIIGAGGAGLRAAMGLGEAGF-KTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTAKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGK-G-GVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGR----CVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGV-G-PEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVI---KY----TKEGGDK----IVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSI-NIKEELK-PDE-KIPELP-EGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLSKE