@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Rv3339c: (2016-05-19 )
MSNAPKIKVSGPVVELDGDEMTRVIWKLIKDMLILPYLDIRLDYYDLGIEHRDATDDQVTIDAAYAIKKHGVGVKCATITPDEARVEEFNLKKMWLSPNGTIRNILGGTIFREPIVISNVPRLVPGWTKPIVIGRHAFGDQYRATNFKVDQPGTVTLTFTPADGSAPIVHEMVSIPEDGGVVLGMYNFKESIRDFARASFSYGLNAKWPVYLSTKNTILKAYDGMFKDEFERVYEEEFKAQFEAAGLTYEHRLIDDMVAACLKWEGGYVWACKNYDGDVQSDTVAQGYGSLGLMTSVLMTADGKTVEAEAAHGTVTRHYRQYQAGKPTSTNPIASIFAWTRGLQHRGKLDGTPEVIDFAHKLESVVIATVESGKMTKDLAILIGPEQDWLNSEEFLDAIADNLEKELAN

Atome Classification :

(46 SA) .........10........20........30........40........50........60........70........80........90........100.......110.........120-........130.......140.......150-.......160..--....-.170....-...-180....-...190.......200.......210.......220.......230.......240.......250.......260.......270.......280.......290.......300.......310.......320.......330.......340.......350.......360.......370.......380..------.------..-..390.......400.......-
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MSNAPKIKVSGPVVELDGDEMTRVIWKLIKDMLILPYLDIRLDYYDLGIEHRDATDDQVTIDAAYAIKKHGVGVKCATITPDEARVEEFNLKKMWLSPNGTIRNILGGTI--FREPIVISNVP--RLVPGWTKPIVIGRHAFGDQYRATNFKVDQP-GTVTLTFTPADG--SAPI-VHEMVSIP-EDG-GVVLGMY-NFKESIRDFARASFSYGLNAKWPVYLSTKNTILKAYDGMFKDEFERVYEEEFKAQFEAAGLTYEHRLIDDMVAACLKWEGGYVWACKNYDGDVQSDTVAQGYGSLGLMTSVLMTADGKTVEAEAAHGTVTRHYRQYQAGKPTSTNPIASIFAWTRGLQHRGKLDGTPEVIDFAHKLESVVIATVESGKMTKDLAILIG------P------EQ-DWLNSEEFLDAIADNLEKELAN-
1 PsiBlast_PDB 96.58100% -95 - C8 -4HCX IDH_MYCTU A:[5-406] ----PKIKVSGPVVELDGDEMTRVIWKLIKDMLILPYLDIRLDYYDLGIEHRDATDDQVTIDAAYAIKKHGVGVKCATITPDEARVEEFNLKKMWLSPNGTIRNILGGTI--FREPIVISNVP--RLVPGWTKPIVIGRHAFGDQYRATNFKVDQP-GTVTLTFTPADG--SAPI-VHEMVSIP-EDG-GVVLGMY-NFKESIRDFARASFSYGLNAKWPVYLSTKNTILKAYDGMFKDEFERVYEEEFKAQFEAAGLTYEHRLIDDMVAACLKWEGGYVWACKNYDGDVQSDTVAQGYGSLGLMTSVLMTADGKTVEAEAAHGTVTRHYRQYQAGKPTSTNPIASIFAWTRGLQHRGKLDGTPEVIDFAHKLESVVIATVESGKMTKDLAILIG------P------EQ-DWLNSEEFLDAIADNLEKE----
21 PsiBlast_CBE 96.51100% -95 - C8 -4HCX IDH_MYCTU B:[5-406] ----PKIKVSGPVVELDGDEMTRVIWKLIKDMLILPYLDIRLDYYDLGIEHRDATDDQVTIDAAYAIKKHGVGVKCATITPDEARVEEFNLKKMWLSPNGTIRNILGGTI--FREPIVISNVP--RLVPGWTKPIVIGRHAFGDQYRATNFKVDQP-GTVTLTFTPADG--SAPI-VHEMVSIP-EDG-GVVLGMY-NFKESIRDFARASFSYGLNAKWPVYLSTKNTILKAYDGMFKDEFERVYEEEFKAQFEAAGLTYEHRLIDDMVAACLKWEGGYVWACKNYDGDVQSDTVAQGYGSLGLMTSVLMTADGKTVEAEAAHGTVTRHYRQYQAGKPTSTNPIASIFAWTRGLQHRGKLDGTPEVIDFAHKLESVVIATVESGKMTKDLAILIG------P------EQ-DWLNSEEFLDAIADNLEKE----
105 HHSearch 93.9497% -88 - C8 -4HCX IDH_MYCTU A:[5-406] ----PKIKVSGPVVELDGDEMTRVIWKLIKDMLILPYLDIRLDYYDLGIEHRDATDDQVTIDAAYAIKKHGVGVKCATITPDEARVEEFNLKKMWLSPNGTIRNILGGTI--FREPI--VISNVPRLVPGWTKPIVIGRHAFGDQYRATNFKVDQP-GTVTLTFTPADG--SAPI-VHEMVSIP--ED-GGVVLGMYNFKESIRDFARASFSYGLNAKWPVYLSTKNTILKAYDGMFKDEFERVYEEEFKAQFEAAGLTYEHRLIDDMVAACLKWEGGYVWACKNYDGDVQSDTVAQGYGSLGLMTSVLMTADGKTVEAEAAHGTVTRHYRQYQAGKPTSTNPIASIFAWTRGLQHRGKLDGTPEVIDFAHKLESVVIATVESGKMTKDLAILIG------P------EQ-DWLNSEEFLDAIADNLEKE----
2 PsiBlast_PDB 91.7571% -92 - C8 -3US8 ? A:[25-425] ----AKIKVANPVVELDGDEMTRIIWQFIKDKLIHPYLDLDLEYYDLGVENRDATDDQVTIDAANAIKKHGVGVKCATITPDEGRVEEFKLKKMWKSPNGTIRNILGGVI--FREPIICKNVP--RLVPGWTKPIIVGRHAFGDQYRATDFKFPGK-GKLSIKFVGEDG--QT-I-EHDVYDAP--GA-GVALAMY-NLDESITEFARASFNYGLQRKVPVYLSTKNTILKAYDGRFKDIFQKVFDEEFAAQFKAEKLWYEHRLIDDMVASALKWSGGYVWACKNYDGDVQSDIVAQGFGSLGLMTSVLMTPDGKTVEAEAAHGTVTRHYRQHQKGEETSTNSIASIFAWTRGLAHRAKLDGNAELAKFSETLERVCVDTVESGFMTKDLALLIG------P------DQ-PWLSTTGFLDKIDENLRKAM---
8 PsiBlast_PDB 89.8865% -87 - C8 -2CMV IDHC_MOUSE A:[5-408] ----------GSVVEMQGDEMTRIIWELIKEKLILPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKYNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTV--FREAIICKNIP--RLVTGWVKPIIIGRHAYGDQYRATDFVVPGP-GKVEITYTPKDG--TQKV-TYMVHDFE-EGG-GVAMGMY-NQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKKYKSQFEAQNICYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLICPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWSRGLAHRAKLDNNTELSFFAKALEDVCIETIEAGFMTKDLAACIKGLPNV-Q------RS-DYLNTFEFMDKLGENLKAKLAQ-
95 Fugue 89.5665% -91 - C8 -1LWD IDHP_PIG A:[1-413] --ADQRIKVAKPVVEMDGDEMTRIIWQFIKEKLILPHVDVQLKYFDLGLPNRDQTNDQVTIDSALATQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIRNILGGTV--FREPIICKNIP--RLVPGWTKPITIGRHAHGDQYKATDFVVDRA-GTFKIVFTPKDG--SSAK-QWEVYNFP--AG-GVGMGMY-NTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFEKHYKTDFDKYKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQTLEKVCVETVESGAMTKDLAGCIHGLSNVKL------NE-HFLNTSDFLDTIKSNLDRALGRQ
50 PsiBlast_CBE 89.5365% -87 - C8 -4L06 IDHC_HUMAN C:[8-411] ----------GSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKHNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTV--FREAIICKNIP--RLVSGWVKPIIIGRHAYGDQDRATDFVVPGP-GKVEITYTPSDG--TQKV-TYLVHNFE-EGG-GVAMGMY-NQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFEAQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNV-Q------RS-DYLNTFEFMDKLGENLKIKLAQ-
3 PsiBlast_PDB 89.2165% -91 - C8 -1LWD IDHP_PIG A:[4-411] -----RIKVAKPVVEMDGDEMTRIIWQFIKEKLILPHVDVQLKYFDLGLPNRDQTNDQVTIDSALATQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIRNILGGTV--FREPIICKNIP--RLVPGWTKPITIGRHAHGDQYKATDFVVDRA-GTFKIVFTPKDG--SSAK-QWEVYNFP-A-G-GVGMGMY-NTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFEKHYKTDFDKYKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQTLEKVCVETVESGAMTKDLAGCIH------GLSNVKLNE-HFLNTSDFLDTIKSNLDRALG--
28 PsiBlast_CBE 89.0865% -86 - C8 -2CMJ IDHC_MOUSE B:[5-408] ----------GSVVEMQGDEMTRIIWELIKEKLILPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKYNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTV--FREAIICKNIP--RLVTGWVKPIIIGRHAYGDQYRATDFVVPGP-GKVEITYTPKDG--TQKV-TYMVHDFE-EGG-GVAMGMY-NQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKKYKSQFEAQNICYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLICPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWSRGLAHRAKLDNNTELSFFAKALEDVCIETIEAGFMTKDLAACIKGLPNV-Q------RS-DYLNTFEFMDKLGENLKAKLAQ-
19 PsiBlast_PDB 88.9165% -88 - C8 -4L06 IDHC_HUMAN A:[8-411] ----------GSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKHNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTV--FREAIICKNIP--RLVSGWVKPIIIGRHAYGDQDRATDFVVPGP-GKVEITYTPSDG--TQKV-TYLVHNFE-EGG-GVAMGMY-NQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFEAQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNV-Q------RS-DYLNTFEFMDKLGENLKIKLAQ-
37 PsiBlast_CBE 88.8265% -90 - C8 -4UMX IDHC_HUMAN B:[8-411] ----------GSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKHNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTV--FREAIICKNIP--RLVSGWVKPIIIGHHAYGDQYRATDFVVPGP-GKVEITYTPSDG--TQKV-TYLVHNFE-EGG-GVAMGMY-NQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFEAQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQS-------GSLGMMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNV-Q------RS-DYLNTFEFMDKLGENLKIKLAQ-
7 PsiBlast_PDB 88.8265% -84 - C8 -2CMJ IDHC_MOUSE A:[5-408] ----------GSVVEMQGDEMTRIIWELIKEKLILPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKYNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTV--FREAIICKNIP--RLVTGWVKPIIIGRHAYGDQYRATDFVVPGP-GKVEITYTPKDG--TQKV-TYMVHDFE-EGG-GVAMGMY-NQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKKYKSQFEAQNICYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLICPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWSRGLAHRAKLDNNTELSFFAKALEDVCIETIEAGFMTKDLAACIKGLPNV-Q------RS-DYLNTFEFMDKLGENLKAKLAQ-
22 PsiBlast_CBE 88.7565% -92 - C8 -1LWD IDHP_PIG B:[4-411] -----RIKVAKPVVEMDGDEMTRIIWQFIKEKLILPHVDVQLKYFDLGLPNRDQTNDQVTIDSALATQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIRNILGGTV--FREPIICKNIP--RLVPGWTKPITIGRHAHGDQYKATDFVVDRA-GTFKIVFTPKDG--SSAK-QWEVYNFP-A-G-GVGMGMY-NTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFEKHYKTDFDKYKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQTLEKVCVETVESGAMTKDLAGCIH------GLSNVKLNE-HFLNTSDFLDTIKSNLDRALG--
25 PsiBlast_CBE 88.6165% -86 - C8 -1T0L IDHC_HUMAN B:[8-411] ----------GSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKHNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTV--FREAIICKNIP--RLVSGWVKPIIIGRHAYGDQYRATDFVVPGP-GKVEITYTPSDG--TQKV-TYLVHNFE-EGG-GVAMGMY-NQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFEAQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNV-Q------RS-DYLNTFEFMDKLGENLKIKLAQ-
10 PsiBlast_PDB 88.5764% -90 - C8 -4JA8 IDHP_HUMAN A:[3-410] -----RIKVAKPVVEMDGDEMTRIIWQFIKEKLILPHVDIQLKYFDLGLPNRDQTDDQVTIDSALATQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIQNILGGTV--FREPIICKNIP--RLVPGWTKPITIGRHAHGDQYKATDFVADRA-GTFKMVFTPKDG--SGVK-EWEVYNFP-A-G-GVGMGMY-NTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDKNKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIH------GLSNVKLNE-HFLNTTDFLDTIKSNLDRALG--
16 PsiBlast_PDB 88.5665% -90 - C8 -4UMY IDHC_HUMAN A:[8-411] ----------GSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKHNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTV--FREAIICKNIP--RLVSGWVKPIIIGHH------RATDFVVPGP-GKVEITYTPSDG--TQKV-TYLVHNFE-EGG-GVAMGMY-NQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFEAQKIWYEHRLIDDMVAQAMKSEGGFIWACKN--------------GSLGMMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNV-Q------RS-DYLNTFEFMDKLGENLKIKLAQ-
47 PsiBlast_CBE 88.4065% -86 - C8 -4L06 IDHC_HUMAN F:[8-411] ----------GSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKHNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTV--FREAIICKNIP--RLVSGWVKPIIIGRHAYGDQDRATDFVVPGP-GKVEITYTPSDG--TQKV-TYLVHNFE-EGG-GVAMGMY-NQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFEAQKIWYEHRLIDDMVAQAMKSEG