@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Rv3411c: (2016-05-19 )
MSRGMSGLEDSSDLVVSPYVRMGGLTTDPVPTGGDDPHKVAMLGLTFDDVLLLPAASDVVPATADTSSQLTKKIRLKVPLVSSAMDTVTESRMAIAMARAGGMGVLHRNLPVAEQAGQVEMVKRSEAGMVTDPVTCRPDNTLAQVDALCARFRISGLPVVDDDGALVGIITNRDMRFEVDQSKQVAEVMTKAPLITAQEGVSASAALGLLRRNKIEKLPVVDGRGRLTGLITVKDFVKTEQHPLATKDSDGRLLVGAAVGVGGDAWVRAMMLVDAGVDVLVVDTAHAHNRLVLDMVGKLKSEVGDRVEVVGGNVATRSAAAALVDAGADAVKVGVGPGSICTTRVVAGVGAPQITAILEAVAACRPAGVPVIADGGLQYSGDIAKALAAGASTAMLGSLLAGTAEAPGELIFVNGKQYKSYRGMGSLGAMRGRGGATSYSKDRYFADDALSEDKLVPEGIEGRVPFRGPLSSVIHQLTGGLRAAMGYTGSPTIEVLQQAQFVRITPAGLKESHPHDVAMTVEAPNYYAR

Atome Classification :

(59 SA) .........10........20........30........40........50........60--........70------.........80........90........100.......110.......120.--......130.......140.......150.......160-.---.---......170.....-..180.....-..190-.--....-...200..---------.....210.-......220.......230.......240.......250-.......260.......270.......280.......290.......300.......310.......320.......330.......340.......350.......360....------...370.......380.......390.......400.......410.......420.......430-.....---..440.....-..450...-....460.......470.......480.......490.-....-.-.500.......510.......520.......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MSRGMSGLEDSSDLVVSPYVRMGGLTTDPVPTGGDDPHKVAMLGLTFDDVLLLPAASDVVP--ATADTSSQL-------TKKIRLKVPLVSSAMDTVTESRMAIAMARAGGMGVLHRNLPVAEQAGQVEMVK--RSEAGMVTDPVTCRPDNTLAQVDALCARFRISGLPVVD--D---D---GALVGIITNRDMRF-EVDQSKQVAE-VMT-K-A--PLIT-AQEGVSAS---------AALGLLRRN-KIEKLPVVDGRGRLTGLITVKDFVKTEQHPLATKDSDGR-LLVGAAVGVGGDAWVRAMMLVDAGVDVLVVDTAHAHNRLVLDMVGKLKSEVGDRVEVVGGNVATRSAAAALVDAGADAVKVGVGPGSICTTRVVAGVGAPQITAILEAVAACRP------AGVPVIADGGLQYSGDIAKALAAGASTAMLGSLLAGTAEAPGELIFVNGKQYKSYRGMGSLGAMRG-RGGAT---SYSKDRYFAD-DALSEDKL-VPEGIEGRVPFRGPLSSVIHQLTGGLRAAMGYTGSPTI-EVLQ-Q-AQFVRITPAGLKESHPHDVAMTVEAPNYYAR
121 HHSearch 84.3955% -93 - C2 -4FXS ? A:[6-486] ---------------------------------------IAKEALTFDDVLLVPAHSTVLP--NTADLRTRL-------TKNIALNIPMVSASMDTVTEARLAIALAQEGGIGFIHKNMSIEQQAAQVHQVK--IFEA--VTHPVTVRPEQTIADVMELTHYHGFAGFPVVT--E---N---NELVGIITGRDVRF-VTDLTKSVAA-VMT---PKERLAT-VKEG-------------EVQEKMH----VEKILVVNDEFQLKGMITAK-----ESKPNACKDEQGR-LRVGAAVGAAPGNEERVKALVEAGVDVLLIDSSHGHSEGVLQRIRETRAAYP-HLEIIGGNVATAEGARALIEAGVSAVKVGIGPGSICTTRIVTGVGVPQITAIADAAGVANE------YGIPVIADGGIRFSGDISKAIAAGASCVMVGSMFAGTEEAPGEVILYQGRSYKAYRGMGSLGAMSK-G---------SSDRYFQT-----ADKL-VPEGIEGRIAYKGHLKEIIHQQMGGLRSCMGLTGSATV-EDLRTK-AQFVRISGAGMKESHVHDVQITKEAPNY---
6 PsiBlast_PDB 84.3254% -87 - C2 -3TSB ? A:[29-509] --------------------------------------KFVKEGLTFDDVLLVPAKSDVLP--REVSVKTVL-------SESLQLNIPLISAGMDTVTEADMAIAMARQGGLGIIHKNMSIEQQAEQVDKVK--RSESGVISDPFFLTPEHQVYDAEHLMGKYRISGVPVVNNLD---E---RKLVGIITNRDMRF-IQDYSIKISD-VMT-K-E--QLIT-APVGTTLS---------EAEKILQKY-KIEKLPLVDNNGVLQGLITIKDIEKVIEFPNSAKDKQGR-LLVGAAVGVTADAMTRIDALVKASVDAIVLDTAHGHSQGVIDKVKEVRAKY-PSLNIIAGNVATAEATKALIEAGANVVKVGIGPGSICTTRVVAGVGVPQLTAVYDCATEARK------HGIPVIADGGIKYSGDMVKALAAGAHVVMLGSMFAGVAESPGETEIYQGRQFKVYRGMGSVGAME--KG--------SKDRYFQE----GNKKL-VPEGIEGRVPYKGPLADTVHQLVGGLRAGMGYCGAQDL-EFLR-ENAQFIRMSGAGLLESHPHHVQITKEAPNY---
10 PsiBlast_PDB 83.5552% -93 - C2 -4FXS ? A:[5-486] --------------------------------------RIAKEALTFDDVLLVPAHSTVLP--NTADLRTRL-------TKNIALNIPMVSASMDTVTEARLAIALAQEGGIGFIHKNMSIEQQAAQVHQVK--IFEA--VTHPVTVRPEQTIADVMELTHYHGFAGFPVVT--E---N---NELVGIITGRDVRF-VTDLTKSVAA-VMTPK-E--RLAT-VKEG-------------EVQEKMH----VEKILVVNDEFQLKGMITAK-----ESKPNACKDEQGR-LRVGAAVGAAPGNEERVKALVEAGVDVLLIDSSHGHSEGVLQRIRETRAAY-PHLEIIGGNVATAEGARALIEAGVSAVKVGIGPGSICTTRIVTGVGVPQITAIADAAGVANE------YGIPVIADGGIRFSGDISKAIAAGASCVMVGSMFAGTEEAPGEVILYQGRSYKAYRGMGSLGAM-------S---KGSSDRYFQT----A-DKL-VPEGIEGRIAYKGHLKEIIHQQMGGLRSCMGLTGSATV-EDLRTK-AQFVRISGAGMKESHVHDVQITKEAPNY---
125 HHSearch 83.2397%-108 - C2 -4ZQM IMDH_MYCTU A:[31-387] ---------------------------DPVPTGGDDPHKVAMLGLTFDDVLLLPAASDVVP--ATADTSSQL-------TKKIRLKVPLVSSAMDTVTESRMAIAMARAGGMGVLHRNLPVA--------------------------------EQAGQVEM----------------------------------------------------------------------------------VKRS---GGLL------------------------------------VGAAVGVGGDAWVRAMMLVDAGVDVLVVDTAHAHNRLVLDMVGKLKSEVGDRVEVVGGNVATRSAAAALVDAGADAVKVGVGPGSICTTRVVAGVGAPQITAILEAVAACRP------AGVPVIADGGLQYSGDIAKALAAGASTAMLGSLLAGTAEAPGELIFVNGKQYKSYRGMGSLGAM-----------------------------L-VPEGIEGRVPFRGPLSSVIHQLTGGLRAAMGYTGSPTI-EVLQ-Q-AQFVRITPAGL--------------------
117 HHSearch 81.8552% -87 - C2 -1ZFJ IMDH_STRPY A:[8-490] ----------------------------------------LKKGYTFDDVLLIPAESHVLP--NEVDLKTKL-------ADNLTLNIPIITAAMDTVTGSKMAIAIARAGGLGVIHKNMSITEQAEEVRKVK--RSENGVIIDPFFLTPEHKVSEAEELMQRYRISGVPIVE--TLA-N---RKLVGIITNRDMRF-ISDYNAPISE-HMT-S-E--HLVT-AAVGTDLE---------TAERILHEH-RIEKLPLVDNSGRLSGLITIKDIEKVIEFPHAAKDEFGR-LLVAAAVGVTSDTFERAEALFEAGADAIVIDTAHGHSAGVLRKIAEIRAHFP-NRTLIAGNIATAEGARALYDAGVDVVKVGIGPGSICTTRVVAGVGVPQVTAIYDAAAVARE------YGKTIIADGGIKYSGDIVKALAAGGNAVMLGSMFAGTDEAPGETEIYQGRKYKTYRGMGSIAAMKK-------------------------NKL-VPEGIEGRVAYKGAASDIVFQMLGGIRSGMGYVGAGDI-QELHEN-AQFVEMSGAGLIESHPHDVQITNEAPNYS--
11 PsiBlast_PDB 81.0350% -87 - C2 -1ZFJ IMDH_STRPY A:[6-489] --------------------------------------KFLKKGYTFDDVLLIPAESHVLP--NEVDLKTKL-------ADNLTLNIPIITAAMDTVTGSKMAIAIARAGGLGVIHKNMSITEQAEEVRKVK--RSENGVIIDPFFLTPEHKVSEAEELMQRYRISGVPIVE--TLA-N---RKLVGIITNRDMRF-ISDYNAPISE-HMT-S-E--HLVT-AAVGTDLE---------TAERILHEH-RIEKLPLVDNSGRLSGLITIKDIEKVIEFPHAAKDEFGR-LLVAAAVGVTSDTFERAEALFEAGADAIVIDTAHGHSAGVLRKIAEIRAHFPNRT-LIAGNIATAEGARALYDAGVDVVKVGIGPGSICTTRVVAGVGVPQVTAIYDAAAVARE------YGKTIIADGGIKYSGDIVKALAAGGNAVMLGSMFAGTDEAPGETEIYQGRKYKTYRGMGSIAAMK--K-----------------------NKL-VPEGIEGRVAYKGAASDIVFQMLGGIRSGMGYVGAGDI-QELH-ENAQFVEMSGAGLIESHPHDVQITNEAPNY---
7 PsiBlast_PDB 79.3954% -95 - C2 -3TSD ? A:[29-497] --------------------------------------KFVKEGLTFDDVLLVPAKSDVLP--REVSVKTVL-------SESLQLNIPLISAGMDTVTEADMAIAMARQGGLGIIHKNMSIEQQAEQVDKVK--RSESGVISDPFFLTPEHQVYDAEHLMGKYRISGVPVVNNLD---E---RKLVGIITNRDMRF-IQDYSIKISD-VM--K-E--QLIT-APVGTTLS---------EAEKILQKY-KIEKLPLVDNNGVLQGLITIKDIEKVIEFPNSAKDKQGR-LLVGAAVGVTADAMTRIDALVKASVDAIVLDTAHGHSQGVIDKVKEVRAKY-PSLNIIAGNVATAEATKALIEAGANVVKVGIGPGSICTTRVVAGVGVPQLTAVYDCATEARK------HGIPVIADGGIKYSGDMVKALAAGAHVVMLGSMFAGVAESPGE------RQFKVYRG-------------------------------------------EGRVPYKGPLADTVHQLVGGLRAGMGYCGAQDL-EFLR-ENAQFIRMSGAGLLESHP---------------
115 HHSearch 78.2155% -98 - C2 -3USB ? A:[29-493] --------------------------------------KFVKEGLTFDDVLLVPAKSDVLP--REVSVKTVL-------SESLQLNIPLISAGMDTVTEADMAIAMARQGGLGIIHKNMSIEQQAEQVDKVK--RSESGVISDPFFLTPEHQVYDAEHLMGKYRISGVPVVN--NLD-E---RKLVGIITNRDMRF-IQDYSIKISD-VMT---KE-QLIT-APVGTTLS---------EAEKILQKY-KIEKLPLVDNNGVLQGLITIKDIEKVIEFPNSAKDKQGR-LLVGAAVGVTADAMTRIDALVKASVDAIVLDTAHGHSQGVIDKVKEVRAKYP-SLNIIAGNVATAEATKALIEAGANVVKVGIGPGSICTTRVVAGVGVPQLTAVYDCATEARK------HGIPVIADGGIKYSGDMVKALAAGAHVVMLGSMFAGVAESPGETEIYQGRQFKV-------------------------------------------------VPYKGPLADTVHQLVGGLRAGMGYCGAQDL-EFLREN-AQFIRMSGAGLL-------------------
9 PsiBlast_PDB 77.3452% -98 - C2 -3USB ? A:[29-493] --------------------------------------KFVKEGLTFDDVLLVPAKSDVLP--REVSVKTVL-------SESLQLNIPLISAGMDTVTEADMAIAMARQGGLGIIHKNMSIEQQAEQVDKVK--RSESGVISDPFFLTPEHQVYDAEHLMGKYRISGVPVVNNLD---E---RKLVGIITNRDMRF-IQDYSIKISD-VMT-K-E--QLIT-APVGTTLS---------EAEKILQKY-KIEKLPLVDNNGVLQGLITIKDIEKVIEFPNSAKDKQGR-LLVGAAVGVTADAMTRIDALVKASVDAIVLDTAHGHSQGVIDKVKEVRAKY-PSLNIIAGNVATAEATKALIEAGANVVKVGIGPGSICTTRVVAGVGVPQLTAVYDCATEARK------HGIPVIADGGIKYSGDMVKALAAGAHVVMLGSMFAGVAESPGETEIYQGRQFKV-------------------------------------------------VPYKGPLADTVHQLVGGLRAGMGYCGAQDL-EFLR-ENAQFIRMSGAGLL-------------------
14 PsiBlast_PDB 76.8654%-106 - C2 -4DQW ? A:[23-486] --------------------------------------RISQEALTFDDVLLIPGYSEVLP--KDVSLKTRL-------TRGIELNIPLVSAAMDTVTEARLAIAMAQEGGIGIIHKNMGIEQQAAEVRKVK--KHETAIVRDPVTVTPSTKIIELLQMAREYGFSGFPVVE--Q-------GELVGIVTGRDLRV-KPNAGDTVAA-IMTPK-D--KLVT-AREGTPLE---------EMKAKLYEN-RIEKMLVVDENFYLRGLVTFRDIEKAKTYPLASKDEQGR-LRVGAAVGTGADTGERVAALVAAGVDVVVVDTAHGHSKGVIERVRWVKQTFPD-VQVIGGNIATAEAAKALAEAGADAVKVGIGPGSICTTRIVAGVGVPQISAIANVAAALEG------TGVPLIADGGIRFSGDLAKAMVAGAYCVMMGSMFAGTEEAPGE-------------------------------------------------------------PYKGALSAIVHQLMGGLRAAMGYTGSADI-QQMRTQ-PQFVRITG-----------------------
26 PsiBlast_CBE 76.7343% -93 - C2 -4Z87 ? B:[38-477] -------------------------------------------GLTYNDFLVLPGKIDFPS--SEVVLSSRL-------TKKITLNAPFVSSPMDTVTEADMAIHMALLGGIGIIHHNCTAEEQAEMVRRVK--KYENGFINAPVVVGPDATVADVRRMKNEFGFAGFPVTD--DGKPT---GKLQGIITSRDIQF-VEDETLLVSE-IMT-K----DVIT-GKQGINLE---------EANQILKNT-KKGKLPIVDEAGCLVSMLSRTDLMKNQSYPLASKSADTKQLLCGAAIGTIDADRQRLAMLVEAGLDVVVLDSSQGNSVFQINMIKWIKETFPD-LQVIAGNVVTREQAASLIHAGADGLRIGMGSGSICITQEVMACGRPQGTAVYNVTQFANQ------FGVPCIADGGVQNIGHITKAIALGASTVMMGGMLAGTTESPGEYFFRDGKRLKTYRGMGSIDAMQ------------------------------VAQGVTGSVIDKGSIKKYIPYLYNGLQ--------------------------------------------------
25 PsiBlast_CBE 76.7243% -94 - C2 -4Z87 ? C:[38-476] -------------------------------------------GLTYNDFLVLPGKIDFPS--SEVVLSSRL-------TKKITLNAPFVSSPMDTVTEADMAIHMALLGGIGIIHHNCTAEEQAEMVRRVK--KYENGFINAPVVVGPDATVADVRRMKNEFGFAGFPVTD--DGKP----GKLQGIITSRDIQF-VEDETLLVSE-IMT-K----DVIT-GKQGINLE---------EANQILKNT-KKGKLPIVDEAGCLVSMLSRTDLMKNQSYPLASKSADTKQLLCGAAIGTIDADRQRLAMLVEAGLDVVVLDSSQGNSVFQINMIKWIKETFPD-LQVIAGNVVTREQAASLIHAGADGLRIGMGSGSICITQEVMACGRPQGTAVYNVTQFANQ------FGVPCIADGGVQNIGHITKAIALGASTVMMGGMLAGTTESPGEYFF-DGKRLKTYRGMGSIDAMQ---------------------------VL-VAQGVTGSVIDKGSIKKYIPYLYNGLQ--------------------------------------------------
30 PsiBlast_CBE 75.9541% -95 - C2 -1NF7 IMDH2_HUMAN B:[10-476] ----------------TSYVPDDGLTAQQLFNCGD--------GLTYNDFLILPGYIDFTA--DQVDLTSAL-------TKKITLKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVK--KYEQGFITDPVVLSPK------------------------------------GIISSRDIDFL--EHDCFLEE-IMT-KRE--DLVV-APAGITLK---------EANEILQRS-KKGKLPIVNEDDELVAIIART-LKKNRDYPLASKDAKKQ-LLCGAAIGTHEDDKYRLDLLAQAGVDVVVLDSSQGNSIFQINMIKYIKDKYPN-LQVIGGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARR------FGVPVIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAM-----------------------------IKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSL---------------------------------------
20 PsiBlast_PDB 75.8341% -93 - C2 -1NF7 IMDH2_HUMAN A:[10-476] ----------------TSYVPDDGLTAQQLFNCGD--------GLTYNDFLILPGYIDFTA--DQVDLTSAL-------TKKITLKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVK--KYEQGFITDPVVLSPK------------------------------------GIISSRDIDFL--EHDCFLEE-IMT-KRE--DLVV-APAGITLK---------EANEILQRS-KKGKLPIVNEDDELVAIIART-LKKNRDYPLASKDAKKQ-LLCGAAIGTHEDDKYRLDLLAQAGVDVVVLDSSQGNSIFQINMIKYIKDKYPN-LQVIGGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARR------FGVPVIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAM-----------------------------IKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSL---------------------------------------
4 PsiBlast_PDB 74.8382% -95 - C2 -4ZQP ? A:[68-406] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DTSSQLTKKIRL-K-V--PLVSSAMDTVTESRMAIAMARAGGMGVLHRN-----LPVAEQAGQV-------EMVK----------RSGG-LLVGAAVGVGGDAWVRAMMLVDAGVDVLVVDTAHAHNRLVLDMVGKLKSEVGDRVEVVGGNVATRSAAAALVDAGADAVKVGVGPGSICTTRVVAGVGAPQITAILEAVAACRP------AGVPVIADGGLQYSGDIAKALAAGASTAMLGSLLAGTAEAPGELIFVNGKQYKSYRGMGSLGAMR---------------------------KL-VPEGIEGRVPFRGPLSSVIHQLTGGLRAAMGYTGSPTI-EVLQ-Q-AQFVRITPAGLKESHPHDVAMTVEAPNYYA-
23 PsiBlast_CBE 74.6882% -91 - C2 -4ZQR ? B:[68-406] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DTSSQLTKKIRL-K-V--PLVSSAMDTVTESRMAIAMARAGGMGVLHRN-----LPVAEQAGQV-------EMVK----------RSGG-LLVGAAVGVGGDAWVRAMMLVDAGVDVLVVDTAHAHNRLVLDMVGKLKSEVGDRVEVVGGNVATRSAAAALVDAGADAVKVGVGPGSICTTRVVAGVGAPQITAILEAVAACRP------AGVPVIADGGLQYSGDIAKALAAGASTAMLGSLLAGTAEAPGELIFVNGKQYKSYRGMGSLGAMR-------------------------EDKL-VPEGIEGRVPFRGPLSSVIHQLTGGLRAAMGYTGSPTI-EVLQ-Q-AQFVRITPAGLKESHPHDVAMTVEAPNYYA-
24 PsiBlast_CBE 74.5154%-110 - C2 -4DQW ? B:[23-486] --------------------------------------RISQEALTFDDVLLIPGYSEVLP--KDVSLKTRL-------TRGIELNIPLVSAAMDTVTEARLAIAMAQEGGIGIIHKNMGIEQQAAEVRKVK--KHETAIVRDPVTVTPSTKIIELLQMAREYGFSGFPVVE--Q-------GELVGIVTGRDLRV------DTVAA-IMTPK-D--KLVT-AREGTPLE---------EMKAKLYEN-RIEKMLVVDENFYLRGLVTFRDIEKAKTYPLASKDEQGR-LRVGAAVGTGADTGERVAALVAAGVDVVVVDTAHGHSKGVIERVRWVKQTFPD-VQVIGGNIATAEAAKALAEAGADAVKVGIGPGSICTTRIVAGVGVPQISAIANVAAALEG------TGVPLIADGGIRFSGDLAKAMVAGAYCVMMGSMFAGTEEAP-------------------------------------------------------------------ALSAIVHQLMGGLRAAMGYTGSADI-QQMRTQ-PQFVRITG-----------------------