@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Rv3545c: (2016-05-20 )
MSWNHQSVEIAVRRTTVPSPNLPPGFDFTDPAIYAERLPVAEFAELRSAAPIWWNGQDPGKGGGFHDGGFWAITKLNDVKEISRHSDVFSSYENGVIPRFKNDIAREDIEVQRFVMLNMDAPHHTRLRKIISRGFTPRAVGRLHDELQERAQKIAAEAAAAGSGDFVEQVSCELPLQAIAGLLGVPQEDRGKLFHWSNEMTGNEDPEYAHIDPKASSAELIGYAMKMAEEKAKNPADDIVTQLIQADIDGEKLSDDEFGFFVVMLAVAGNETTRNSITQGMMAFAEHPDQWELYKKVRPETAADEIVRWATPVTAFQRTALRDYELSGVQIKKGQRVVMFYRSANFDEEVFQDPFTFNILRNPNPHVGFGGTGAHYCIGANLARMTINLIFNAVADHMPDLKPISAPERLRSGWLNGIKHWQVDYTGRCPVAH

Atome Classification :

(51 SA) .........10........20........30.....--...40........50.--.....----..60........70........80........90---........100..-----......110..--------.....120.......130.......140.......150..--.....160-..---.-......170.......180.......190.......200..-----.......--210-...----.-.....220.......230-.......240...-....250.......260.......270.......280.......290--.....---.--...300-.---........310.---.-.....320.......330.......340.......350.......360........370-.......380.......390.......400...-.....410.......420....------...430.
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MSWNHQSVEIAVRRTTVPSPNLPPGFDFTDPAIYAE--RLPVAEFAELRSAAPI--WWNGQ----DPGKGGGFHDGGFWAITKLNDVKEISRHSDVFSS---YENGVIPRFK-ND-----IAREDIEVQRF--------VMLNMDAPHHTRLRKIISRGFTPRAVGRLHDELQERAQKI--AAEAAA---AG---S-GDFVEQVSCELPLQAIAGLLGVPQEDRGKLFHWSNEM--TG-----NEDPEYA--H---IDP----K-ASSAELIGYAMKMAEEKA-KNPADDIVTQLIQ-ADIDGEKLSDDEFGFFVVMLAVAGNETTRNSITQGMMAFAEHPDQ----WELYK---K--VRPE---T---AADEIVRWATPV---T-AFQRTALRDYELSGVQIKKGQRVVMFYRSANFDEEVFQDPFTFNILR-NPNPHVGFGGT-GAHYCIGANLARMTINLIFNAVADHMPD-LKPI-SAPERLRSGWLNGIKHWQVDYT------GRCPVAH
1 PsiBlast_PDB 92.97100% -94 - C4 -2X5W CP125_MYCTU A:[26-434] ------------------SPNLPPGFDFTDPAIYAE--RLPVAEFAELRSAAPI--WWNGQ----DPGKGGGFHDGGFWAITKLNDVKEISRHSDVFSS---YENGVIPRFK-ND-----IAREDIEVQRF--------VMLNMDAPHHTRLRKIISRGFTPRAVGRLHDELQERAQKI--AAEAAA---AG---S-GDFVEQVSCELPLQAIAGLLGVPQEDRGKLFHWSNEM--TG-----NEDPEYA--H---IDP----K-ASSAELIGYAMKMAEEKA-KNPADDIVTQLIQ-ADIDGEKLSDDEFGFFVVMLAVAGNETTRNSITQGMMAFAEHPDQ----WELYK---K--VRPE---T---AADEIVRWATPV---T-AFQRTALRDYELSGVQIKKGQRVVMFYRSANFDEEVFQDPFTFNILR-NPNPHVGFGGT-GAHYCIGANLARMTINLIFNAVADHMPD-LKPI-SAPERLRSGWLNGIKHWQVDYT------G------
6 PsiBlast_PDB 91.9999% -94 - C4 -2X5L CP125_MYCTU A:[18-431] -------------------PNLPPGFDFTDPAIYAE--RLPVAEFAELRSAAPI--WWNGQ----DPGKGGGFHDGGFWAITKLNDVKEISRHSDVFSS---YENGVIPRFK-ND-----IAREDIEVQRF--------VMLNMDAPHHTRLRKIISRGFTPRAVGRLHDELQERAQKI--AAEAAA---AG---S-GDFVEQVSCELPLQAIAGLLGVPQEDRGKLFHWSNEM--TG-----NEDPEYA--H---IDP----K-ASSAELIGYAMKMAEEKA-KNPADDIVTQLIQ-ADIDGEKLSDDEFGFFVVMLAVAGNETTRNSITQGMMAFAEHPDQ----WELYK---K--VRPE---T---AADEIVRWATPV---T-AFQRTALRDYELSGVQIKKGQRVVMFYRSANFDEEVFQDPFTFNILR-NPNPHVGFGGT-GAHYCIGANLARMTINLIFNAVADHMPD-LKPI-SAPERLRSGWLNGIKHWQVDYT------GRLPVAH
3 PsiBlast_PDB 90.81100% -93 - C4 -3IW0 CP125_MYCTU A:[20-426] -------------------PNLPPGFDFTDPAIYAE--RLPVAEFAELRSAAPI--WWNGQ----DPGKGGGFHDGGFWAITKLNDVKEISRHSDVFSS---YENGVIPRFK-ND-----IAREDIEVQRF--------VMLNMDAPHHTRLRKIISRGFTPRAVGRLHDELQERAQKI--AAEAAA---AG---S-GDFVEQVSCELPLQAIAGLLGVPQEDRGKLFHWSNEM--TG-----NEDPEYA--H---IDP----K-ASSAELIGYAMKMAEEKA-KNPADDIVTQLIQ-ADIDGEKLSDDEFGFFVVMLAVAGNETTRNSITQGMMAFAEHPDQ----WELYK---K--VRPE---T---AADEIVRWATPV---T-AFQRTALRDYELSGVQIKKGQRVVMFYRSANFDEEVFQDPFTFNILR-NPNPHVGFGGT-GAHYCIGANLARMTINLIFNAVADHMPD-LKPI-SAPERLRSGWLNGIKHWQVDYT-------------
8 PsiBlast_PDB 90.6999% -98 - C4 -2XN8 CP125_MYCTU A:[9-421] ------------------SPNLPPGFDFTDPAIYAE--RLPVAEFAELRSAAPI--WWNGQ----DPGKGGGFHDGGFWAITKLNDVKEISRHSDVFSS---YENGVIPRFK-ND-----IAREDIEVQRF--------VMLNMDAPHHTRLRKIISRGFTPRAVGRLHDELQERAQKI--AAEAAA---AG---S-GDFVEQVSCELPLQAIAGLLGVPQEDRGKLFHWSNEM--TG-----NEDPEYA--H---IDP----K-ASSAELIGYAMKMAEEKA-K--ADDIVTQLIQ-AD--GEKLSDDEFGFFVVMLAVAGNETTRNSITQGMMAFAEHPDQ----WELYK---K--VRPE---T---AADEIVRWATPV---T-AFQRTALRDYELSGVQIKKGQRVVMFYRSANFDEEVFQDPFTFNILR-NPNPHVGFGGT-GAHYCIGANLARMTINLIFNAVADHMPD-LKPI-SAPERLRSGWLNGIKHWQVDYT------GRLPV--
7 PsiBlast_PDB 90.6499% -95 - C4 -2XC3 CP125_MYCTU A:[10-423] ------------------SPNLPPGFDFTDPAIYAE--RLPVAEFAELRSAAPI--WWNGQ----DPGKGGGFHDGGFWAITKLNDVKEISRHSDVFSS---YENGVIPRFK-ND-----IAREDIEVQRF--------VMLNMDAPHHTRLRKIISRGFTPRAVGRLHDELQERAQKI--AAEAAA---AG---S-GDFVEQVSCELPLQAIAGLLGVPQEDRGKLFHWSNEM--TG-----NEDPEYA--H---IDP----K-ASSAELIGYAMKMAEEKA------DIVTQLIQ-ADIDGEKLSDDEFGFFVVMLAVAGNETTRNSITQGMMAFAEHPDQ----WELYK---K--VRPE---T---AADEIVRWATPV---T-AFQRTALRDYELSGVQIKKGQRVVMFYRSANFDEEVFQDPFTFNILR-NPNPHVGFGGT-GAHYCIGANLARMTINLIFNAVADHMPD-LKPI-SAPERLRSGWLNGIKHWQVDYT------GRLPVA-
2 PsiBlast_PDB 90.33100% -94 - C4 -3IVY CP125_MYCTU A:[20-427] -------------------PNLPPGFDFTDPAIYAE--RLPVAEFAELRSAAPI--WWNGQ----DPGKGGGFHDGGFWAITKLNDVKEISRHSDVFSS---YENGVIPRFK-ND-----IAREDIEVQRF--------VMLNMDAPHHTRLRKIISRGFTPRAVGRLHDELQERAQKI--AAEAAA---AG---S-GDFVEQVSCELPLQAIAGLLGVPQEDRGKLFHWSNEM--TG-----NEDPEYA--H---IDP----K-ASSAELIGYAMKMAEEK--------IVTQLIQ-AD--GEKLSDDEFGFFVVMLAVAGNETTRNSITQGMMAFAEHPDQ----WELYK---K--VRPE---T---AADEIVRWATPV---T-AFQRTALRDYELSGVQIKKGQRVVMFYRSANFDEEVFQDPFTFNILR-NPNPHVGFGGT-GAHYCIGANLARMTINLIFNAVADHMPD-LKPI-SAPERLRSGWLNGIKHWQVDYT------G------
4 PsiBlast_PDB 89.53100% -96 - C4 -3IW1 CP125_MYCTU A:[20-426] -------------------PNLPPGFDFTDPAIYAE--RLPVAEFAELRSAAPI--WWNGQ----DPGKGGGFHDGGFWAITKLNDVKEISRHSDVFSS---YENGVIPRFK-ND-----IAREDIEVQRF--------VMLNMDAPHHTRLRKIISRGFTPRAVGRLHDELQERAQKI--AAEAAA---AG---S-GDFVEQVSCELPLQAIAGLLGVPQEDRGKLFHWSNEM--TG-----NEDPEYA--H---IDP----K-ASSAELIGYAMKMAEEK--------IVTQLIQ-AD--GEKLSDDEFGFFVVMLAVAGNETTRNSITQGMMAFAEHPDQ----WELYK---K--VRPE---T---AADEIVRWATPV---T-AFQRTALRDYELSGVQIKKGQRVVMFYRSANFDEEVFQDPFTFNILR-NPNPHVGFGGT-GAHYCIGANLARMTINLIFNAVADHMPD-LKPI-SAPERLRSGWLNGIKHWQVDYT-------------
110 HHSearch 89.1998% -94 - C4 -3IVY CP125_MYCTU A:[20-427] -------------------PNLPPGFDFTDPAIYAE--RLPVAEFAELRSAAPI--WWNGQ----DPGKGGGFHDGGFWAITKLNDVKEISRHSDVFSS---YENGVIPRFK-NDI----AR-EDIEVQRF--------VMLNMDAPHHTRLRKIISRGFTPRAVGRLHDELQERAQKI--AAEAAA---AG---S-GDFVEQVSCELPLQAIAGLLGVPQEDRGKLFHWSNEM--TG-----NEDPEYA--H---IDP----K-ASSAELIGYAMKMAEEK--------IVTQLIQ-AD--GEKLSDDEFGFFVVMLAVAGNETTRNSITQGMMAFAEHPDQ----WE-LYK--K--VRPE---T---AADEIVRWATPV---T-AFQRTALRDYELSGVQIKKGQRVVMFYRSANFDEEVFQDPFTFNILR-NPNPHVGFGGT-GAHYCIGANLARMTINLIFNAVADHMPD-LKPISAPE-RLRSGWLNGIKHWQVDYT------G------
5 PsiBlast_PDB 88.40100% -95 - C4 -3IW2 CP125_MYCTU A:[20-426] -------------------PNLPPGFDFTDPAIYAE--RLPVAEFAELRSAAPI--WWNGQ----DPGKGGGFHDGGFWAITKLNDVKEISRHSDVFSS---YENGVIPRFK-ND-----IAREDIEVQRF--------VMLNMDAPHHTRLRKIISRGFTPRAVGRLHDELQERAQKI--AAEAAA---AG---S-GDFVEQVSCELPLQAIAGLLGVPQEDRGKLFHWSNEM--TG-----NEDPEYA--H---IDP----K-ASSAELIGYAMKMAEEK--------IVTQLIQ-AD--GEKLSDDEFGFFVVMLAVAGNETTRNSITQGMMAFAEHPDQ----WELYK---K--VRPE---T---AADEIVRWATPV---T-AFQRTALRDYELSGVQIKKGQRVVMFYRSANFDEEVFQDPFTFNILR-NPNPHVGFGGT-GAHYCIGANLARMTINLIFNAVADHMPD-LKPI-SAPERLRSGWLNGIKHWQVDYT-------------
10 PsiBlast_PDB 85.4375% -92 - C4 -4APY ? A:[2-415] -----------------PTPNIPSDFDFLDATLNLE--RLPVEELAELRKSEPI--HWVDV-----PGGTGGFGDKGYWLVTKHADVKEVSRRSDVFGS---SPDGAIPVWP-QD-----MTREAVDLQRA--------VLLNMDAPQHTRLRKIISRGFTPRAIGRLEDELRSRAQKI--AQTAAA---QG---A-GDFVEQVSCELPLQAIAELLGVPQDDRDKLFRWSNEM--TA-----GEDPEYA--D---VDP----A-MSSFELISYAMKMAEERA-VNPTEDIVTKLIE-ADIDGEKLSDDEFGFFVVMLAVAGNETTRNSITHGMIAFAQNPDQ----WELYK---K--ERPE---T---AADEIVRWATPV---S-AFQRTALEDVELGGVQIKKGQRVVMSYRSANFDEEVFEDPHTFNILR-SPNPHVGFGGT-GAHYCIGANLARMTINLIFNAIADNMPD-LKPI-GAPERLKSGWLNGIKHWQVDYTGAGKAS-------
9 PsiBlast_PDB 84.9975% -89 - C4 -5DQN ? A:[2-411] -----------------PTPNIPSDFDFLDATLNLE--RLPVEELAELRKSEPI--HWVDV-----PGGTGGFGDKGYWLVTKHADVKEVSRRSDVFGS---SPDGAIPVYP-QD-----MTREAVDLQRA--------VLLNMDAPQHTRLRKIISRGFTPRAIGRLEDELRSRAQKI--AQTAAA---QG---A-GDFVEQVSCELPLQAIAELLGVPQDDRDKLFRWSNEM--TA-----GEDPEYA--D---VDP----A-MSSFELISYAMKMAEERA-VNPTEDIVTKLIE-ADIDGEKLSDDEFGFFVVMLAVAGNETTRNSITHGMIAFAQNPDQ----WELYK---K--ERPE---T---AADEIVRWATPV---S-AFQRTALEDVELGGVQIKKGQRVVMSYRSANFDEEVFEDPHTFNILR-SPNPHVGFGGT-GAHYCIGANLARMTINLIFNAIADNMPD-LKPI-GAPERLKSGWLNGIKHWQVDYTGA-----------
13 PsiBlast_PDB 70.2830% -89 - C4 -4L0E ? A:[28-426] ---------------TLPIPDDISTINLTDPRTYEV--NDLSEYWRQLRTTRPL--YWH-------PPVGDA---PGFWVVSRYADVMALYKDNKKLTS---EKGNVLVTL---------LAGGDSAAGKM--------LAVT-DGAMHRGLRNVLLKSFSPQALKPIVDQIRVNTTRL--VVDAAR---RG---E-CDFAADVAEQIPLNTISDLLGVPAADREFLLKLNKSA--LS-----SE--DQS--A---TDA----W-LARNEILLYFSELVAERR-AKPTEDVISVLAN-SMVDGKPLTEEVIVLNCYSLILGGDETSRLSMIDSVQTFTQYPDQ----WELLRDG-K--VTLE---S---ATEEVLRWATPA---M-HFGRRAVTDMELHGQVIAAGDVVTLWNNSANRDEEVFADPYAFDLNR-SPNKHITF-GY-GPHFCLGAYLGRAEVHALLDALRTYTTG-FEIT-GEPQRIHSNFLTGLSRLPV----------------
15 PsiBlast_PDB 70.2030% -82 - C4 -4PWV ? A:[30-426] -----------------PIPDDISTINLTDPRTYEV--NDLSEYWRQLRTTRPL--YWH-------PPVGDA---PGFWVVSRYADVMALYKDNKKLTS---EKGNVLVTL---------LAGGDSAAGKM--------LAVT-DGAMHRGLRNVLLKSFSPQALKPIVDQIRVNTTRL--VVDAAR---RG---E-CDFAADVAEQIPLNTISDLLGVPAADREFLLKLNKSA--LS-----SEDADQS--A---TDA----W-LARNEILLYFSELVAERR-AKPTEDVISVLAN-SMVDGKPLTEEVIVLNCYSLILGGDETSRLSMIDSVQTFTQYPDQ----WELLRDG-K--VTLE---S---ATEEVLRWATPA---M-HFGRRAVTDMELHGQVIAAGDVVTLWNNSANRDEEVFADPYAFDLNR-SPNKHITF-GY-GPHFCLGAYLGRAEVHALLDALRTYTTG-FEIT-GEPQRIHSNFLTGLSRLPV----------------
11 PsiBlast_PDB 69.9442% -81 - C4 -2WM4 CP124_MYCTU A:[50-435] --------------------------------------------FATLRREAPISFWPTIE----LPGFVAG---NGHWALTKYDDVFYASRHPDIFSS---YPNITI-----ND-----QTPELAEYFG---------SMIVLDDPRHQRLRSIVSRAFTPKVVARIEAAVRDRAHRL--VSSMIA---NNPDRQ-ADLVSELAGPLPLQIICDMMGIPKADHQRIFHWTNVI--LG-----FGDPDLATDF---DEF----M-QVSADIGAYATALAEDRR-VNHHDDLTSSLVE-AEVDGERLSSREIASFFILLVVAGNETTRNAITHGVLALSRYPEQRDRWWSDFD---G--LAP----T---AVEEIVRWASPV---V-YMRRTLTQDIELRGTKMAAGDKVSLWYCSANRDESKFADPWTFDLAR-NPNPHLGFGGG-GAHFCLGANLARREIRVAFDELRRQMPD-VVAT-EEPARLLSQFIHGIKTLPVTWS-------------
14 PsiBlast_PDB 67.5130% -83 - C4 -4PXH ? A:[30-426] -----------------PIPDDISTINLTDPRTYEV--NDLSEYWRQLRTTRPL--YWH-------PPVGDA---PGFWVVSRYADVMALYKDNKKLTS---EKGNVLVTL---------LAGGDSAAGKM--------LAVT-DGAMHRGLRNVLLKSFSPQALKPIVDQIRVNTTRL--VVDAAR---RG---E-CDFAADVAEQIPLNTISDLLGVPAADREFLLKLNKSA--LS-----SEDADQS--A---TDA----W-LARNEILLYFSELVAERR-AKPTEDVISVLAN-SMVDGKPLTEEVIVLNCYSLILGGDETSRLSMIDSVQTFTQYPDQ----WELLRDG-K--VTLE---S---ATEEVLRWATPA---M-HFGRRAVTDMELHGQVIAAGDVVTLWNNSANRDEEVFADPYAFDLNR-SPNKHITF-GY-GPHFCLGAYLGRAEVHALLDALRTYTTG-FEIT-GEPQRIHSNFLTGLSRLPV----------------
12 PsiBlast_PDB 67.2542% -81 - C4 -2WM5 CP124_MYCTU A:[50-435] --------------------------------------------FATLRREAPISFWPTIE----L---VAG---NGHWALTKYDDVFYASRHPDIFSS---YPNITI-----ND-----QTPELAEYFG---------SMIVLDDPRHQRLRSIVSRAFTPKVVARIEAAVRDRAHRL--VSSMIA---NNPDRQ-ADLVSELAGPLPLQIICDMMGIPKADHQRIFHWTNVI--LG-----FGDPDLATDF---DEF----M-QVSADIGAYATALAEDRR-VNHHDDLTSSLVE-AEVDGERLSSREIASFFILLVVAGNETTRNAITHGVLALSRYPEQRDRWWSDFD---G--LAP----T---AVEEIVRWASPV---V-YMRRTLTQDIELRGTKMAAGDKVSLWYCSANRDESKFADPWTFDLAR-NPNPHLGFGGG-GAHFCLGANLARREIRVAFDELRRQMPD-VVAT-EEPARLLSQFIHGIKTLPVTWS-------------
116 HHSearch 66.4239% -78 - C4 -2WM5 CP124_MYCTU A:[23-435] -----------------PPEVPIADIELGSLDFWALDDDVRDGAFATLRREAPI--SFWPTIELVA--------GNGHWALTKYDDVFYASRHPDIFSS---YPNITINDQT-----------PELAEYFG--------SMIVLDDPRHQRLRSIVSRAFTPKVVARIEAAVRDRAHRL--VSSMIANNPDR---Q-ADLVSELAGPLPLQIICDMMGIPKADHQRIFHWTNVI--LG-----FGDPDLATDF---DEF----M-QVSADIGAYATALAEDRR-VNHHDDLTSSLVE-AEVDGERLSSREIASFFILLVVAGNETTRNAITHGVLALSRYPEQ----RDRWWSDFD--GLAP---T---AVEEIVRWASPV---V-YMRRTLTQDIELRGTKMAAGDKVSLWYCSANRDESKFADPWTFDLAR-NPNPHLGFG-GGGAHFCLGANLARREIRVAFDELRRQMPD-VVATEEPARL-LSQFIHGIKTLPVTWS-------------
16 PsiBlast_PDB 64.7430% -93 - C4 -4RM4 YJIB_BACSU A:[26-394] ----------------------------------------PFPWYESMRKDAPV--SFDEE----N----------QVWSVFLYDDVKKVVGDKELFSS-------CM-------------GNS----------------IINMDPPKHTKIRSVVNKAFTPRVMKQWEPRIQEITDEL--IQKFQG---RS---E-FDLVHDFSYPLPVIVISELLGVPSAHMEQFKAWSDLL--VSTPKDKSEEAEKA--F---LEE----RDKCEEELAAFFAGIIEEKR-NKPEQDIISILVE-----GEKLSGEELIPFCTLLLVAGNETTTNLISNAMYSILETPGV----YEELR---S---HPE---LMPQAVEEALRFRAPA---P-VLRRIAKRDTEIGGHLIKEGDMVLAFVASANRDEAKFDRPHMFDIRR-HPNPHIAFGH--GIHFCLGAPLARLEANIALTSLISAFPH-MECV-SITP-IENSVIYGLKSFRV----------------
114 HHSearch 64.6528% -89 - C4 -3TKT ? A:[46-450] ---------------------------------------PLLDRFDALRAEAPV--AKVVAPDD-E--------HEPFWLVSSFDGVMKASKDNATFLN---NPKSTVFTLRVGEMMAKAIT-GGSPHLVE--------SLVQMDAPKHPKLRRLTQDWFMPKNLARLDGEIRKIANEA--IDRMLGA--GE---E-GDFMALVAAPYPLHVVMQILGVPPEDEPKMLFLTQQM--FG-----G---------QISQIV----A-GAVAEFERYFAGLAAERR-RNPTDDVATVIAN-AVVDGEPMSDRDTAGYYIITASAGHDTTSASSAGAALALARDPDL----FARVKAD-R--NLLP---G---IVEEAIRWTTPV---Q-HFMRTAATDTELCGQKIAAGDWLMLNYVAANHDPAQFPEPRKFDPTR-PANRHLAFG-A-GSHQCLGLHLARLEMRVLLDVLLDRV-DSLELAGEPK-RVNSTFVGGFKSLPMRWK------AA-----
30 PsiBlast_CBE 62.8532% -91 - C4 -3RWL ? A:[62-422] ---------------------------------------------------------------------------GPYWSITKYNDIMHVDTNHDIFSSDAGYGGIIIDDGI-------------LDLPNF--------IA--MDRPRHDEQRKAVSPIVAPANLAALEGTIRERVSKT--LDGLPV---GE---E-FDWVDRVSIEITTQMLATLFDFPFEERRKLTRWSDVT--TA-----A--PGGG--V---VESWDQRK-TELLECAAYFQVLWNERVNKDPGNDLISMLAH-SPAT-RNMTPEEYLGNVLLLIVGGNDTTRNSMTGGVLALHKNPDQ----FAKLK---ANPALVE---T---MVPEIIRWQTPL---A-HMRRTAIADSELGGKTIRKGDKVVMWYYSGNRDDEVIDRPEEFIIDRPRPRQHLSF-GF-GIHRCVGNRLAEMQLRILWEEILTRFSR-IEVM-AEPERVRSNFVRGYAKMMV----------------
109 PsiBlast_CBE 61.3133%-103 - C4 -3WVS ? A:[90-378] --------------------------------------------------------------------------------------------------------------------------------------------MFNMDAPDHTRLRRLISKAFTIRRVEELRPKVHDLAHRL--IDDMLA---KG---EPADLVADYALPIPTTVICELLGVPFEDREKFGRWTDAILSTS-----TLNPEEG--R---V---------KRMELVGYIGGIIAARR-AQPADDLISGMIE-ARDVQDKLTEQELLDHCIGLLIAGHETTASQIPSFVYALLDQPQH----WKRLL---D---DPELIPS---AVEELFRF-VPLGSGS-AAPRYAREDIEVGGTLVRAGEPVLVALGAANRDGLRFEDPEEIKLDR-PSNHHIGF-GH-GIHHCLGAPLARLELQEALRALLERLPT-LK--------------------------------------
53 PsiBlast_CBE 60.3134% -95 - C4 -2WHW PIKC_STRVZ B:[112-407] --------------------------------------------------------------------------------------------------------------------------------------------MLESDPPRHTRLRKLVAREFTMRRVELLRPRVQEIVDGLVDAMLAAP---DG---R-ADLMESLAWPLPITVISELLGVPEPDRAAFRVWTDAF--VF-----PDDPAQA-------------Q-TAMAEMSGYLSRLIDSKR-GQDGEDLLSALVRTSDEDGSRLTSEELLGMAHILLVAGHETTVNLIANGMYALLSHPDQ----LAALR---ADMTLLD---G---AVEEMLRYEGPVE--S-ATYRFPVEPVDLDGTVIPAGDTVLVVLADAHRTPERFPDPHRFDIRR-DTAGHLAF-GH-GIHFCIGAPLARLEARIAVRALLERCPD-LALD-VSPGEL-----------------------------
83 PsiBlast_CBE 60.0034% -97 - C4 -4B7D PIKC_STRVZ B:[112-407] --------------------------------------------------------------------------------------------------------------------------------------------MLESDPPRHTRLRKLVAREFTMRRVELLRPRVQEIVDGLVDAMLAAP---DG---R-ADLMESLAWPLPITVISELLGVPEPDRAAFRVWTDAF--VF-----PDDPAQA-------------Q-TAMAEMSGYLSRLIDSKR-GQDGEDLLSALVRTSDEDGSRLTSEELLGMAHILLVAGHETTVNLIANGMYALLSHPDQ----LAALR---ADMTLLD---G---AVEEMLRYEGPVE--S-ATYRFPVEPVDLDGTVIPAGDTVLVVLADAHRTPERFPDPHRFDIRR-DTAGHLAF-GH-GIHFCIGAPLARLEARIAVRALLERCPD-LALD-VSPGEL-----------------------------
77 PsiBlast_CBE 59.9834% -96 - C4 -3ZK5 PIKC_STRVZ B:[112-407] --------------------------------------------------------------------------------------------------------------------------------------------MLESDPPRHTRLRKLVAREFTMRRVELLRPRVQEIVDGLVDAMLAAP---DG---R-ADLMESLAWPLPITVISELLGVPEPDRAAFRVWTDAF--VF-----PDDPAQA-------------Q-TAMAEMSGYLSRLIDSKR-GQDGEDLLSALVRTSDEDGSRLTSEELLGMAHILLVAGHETTVNLIANGMYALLSHPDQ----LAALR---ADMTLLD---G---AVEEMLRYEGPVE--S-ATYRFPVEPVDLDGTVIPAGDTVLVVLADAHRTPERFPDPHRFDIRR-DTAGHLAF-GH-GIHFCIGAPLARLEARIAVRALLERCPD-LALD-VSPGEL-----------------------------
54 PsiBlast_CBE 59.9534% -99 - C4 -2WHW PIKC_STRVZ A:[112-407] --------------------------------------------------------------------------------------------------------------------------------------------MLESDPPRHTRLRKLVAREFTMRRVELLRPRVQEIVDGLVDAMLAAP---DG---R-ADLMESLAWPLPITVISELLGVPEPDRAAFRVWTDAF--VF-----PDDPAQA-------------Q-TAMAEMSGYLSRLIDSKR-GQDGEDLLSALVRTSDEDGSRLTSEELLGMAHILLVAGHETTVNLIANGMYALLSHPDQ----LAALR---ADMTLLD---G---AVEEMLRYEGPVE--S-ATYRFPVEPVDLDGTVIPAGDTVLVVLADAHRTPERFPDPHRFDIRR-DTAGHLAF-GH-GIHFCIGAPLARLEARIAVRALLERCPD-LALD-VSPGEL-----------------------------